CYP17A1 Recombinant monoclonal antibody

• 

  WB analysis using 85690-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85690-5-RR (CYP17A1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 85690-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 85690-5-RR (CYP17A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 85690-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 85690-5-RR (CYP17A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat testis using 85690-5-RR

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 85690-5-RR (CYP17A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat testis using 85690-5-RR

  Immunohistochemical analysis of paraffin-embedded rat testis tissue slide using 85690-5-RR (CYP17A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 85690-5-RR

  Biolayer interferometry (BLl) kinetic assays of 85690-5-RR against Human CYP17A1 were performed. The affinity constant is below 1 pM.

CYP17A1 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 85690-5-RR

Clone No.243076D8

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

17-alpha-hydroxyprogesterone aldolase, CPT7, CYP17, CYPXVII, Cytochrome P450 17A1

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue
• Positive IHC detected in: mouse testis tissue, rat testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85690-5-RR targets CYP17A1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5899

  Product name: Recombinant human CYP17A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 160-508 aa of BC062997

  Sequence: HNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST

• Full Name: cytochrome P450, family 17, subfamily A, polypeptide 1
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 50-57 kDa
• GenBank Accession Number: BC062997
• Gene Symbol: CYP17A1
• Gene ID (NCBI): 1586
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P05093
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochrome P450 17A1 (CYP17A1) is a critical steroidogenic enzyme, essential for producing glucocorticoids and sex hormones (PMID: 33781841). The CYP17A1 gene is expressed in the adrenal cortex and the gonads but not in the placenta (PMID: 19403566). Although CYP17A1 has been shown to be a 50-kDa protein, the presence of a lower molecular mass(30 kDa) immunoreactive form in rat Leydig cells was previously shown and it is either a degradation product or a truncated form of the 50 kDa enzyme (PMID: 15761033). Defects in CYP17A1 are the cause of adrenal hyperplasia type 5 (AH5) and CYP17A1 is an important target for inhibition in the treatment of prostate cancer (PMID: 27505042).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hua (Verified Customer) (09-25-2025)

Very good antibody for WB. Strong signal and clean background.

• Applications: Western Blot
• Primary Antibody Dilution: 1:4000
• Cell Tissue Type: Mouse liver

CYP17A1 Antibody Western Blot validation (1:4000 dilution) in Mouse liver (Cat no:85690-5-RR)