CYP1A1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CYP1A1 Polyclonal antibody (13241-1-AP)

• Featured Product
• KD/KO Validated

CYP1A1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 13241-1-AP Copied!

Publications (161)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

AHH, AHRR, CP11, CYP1, CYPIA1

• 

  WB analysis of mouse cerebellum using 13241-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 13241-1-AP (CYP1A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 13241-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13241-1-AP (CYP1A1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 13241-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13241-1-AP (CYP1A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 13241-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 13241-1-AP (CYP1A1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse lung using 13241-1-AP

  IP result of anti-CYP1A1 (IP:13241-1-AP, 4ug; Detection:13241-1-AP 1:1000) with mouse lung tissue lysate 3600ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 13241-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13241-1-AP (CYP1A1 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 13241-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13241-1-AP (CYP1A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 13241-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13241-1-AP (CYP1A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 13241-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13241-1-AP (CYP1A1 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 13241-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CYP1A1 antibody (13241-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Jurkat using 13241-1-AP

  1x10^6 Jurkat cells were intracellularly stained with 0.25 ug CYP1A1 Polyclonal antibody (13241-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CYP1A1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, mouse cerebellum tissue, mouse lung tissue, rat liver tissue
• Positive IP detected in: mouse lung tissue
• Positive IHC detected in: human liver cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13241-1-AP targets CYP1A1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, zebrafish, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3990

  Product name: Recombinant human CYP1A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 115-465 aa of BC023019

  Sequence: ISNGQSMSFSPDSGPVWAARRRLAQNGLKSFSIASDPASSTSCYLEEHVSKEAEVLISTLQELMAGPGHFNPYRYVVVSVTNVICAICFGRRYDHNHQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTVIGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKLWVNPSEFLPERFLTPDGAIDKVLSEKVIIFGMGKRKCIGETIARW

• Full Name: cytochrome P450, family 1, subfamily A, polypeptide 1
• Calculated Molecular Weight: 512 aa, 58 kDa
• Observed Molecular Weight: 50-58 kDa
• GenBank Accession Number: BC023019
• Gene Symbol: CYP1A1
• Gene ID (NCBI): 1543
• RRID: AB_2877928
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04798
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CYP1A1 Polyclonal antibody (Cat# 13241-1-AP) has 161 citations published in journals including Nature Communications, Signal Transduction and Targeted Therapy, Advanced Science, Phytomedicine, Free Radical Biology and Medicine, FASEB Journal, and iScience. Associated research fields encompass gut microbiota–intestinal barrier regulation, liver disease (NAFLD/HCC), cancer biology, environmental toxicology, oxidative stress, ferroptosis, inflammatory bowel disease, cardiovascular disease, and AHR/CYP1A1 signaling pathways.

Automatically generated from the 161 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Signal Transduct Target Ther; Inducible CD147 up-regulation boosts extended SARS-CoV-2 infection triggering severe COVID-19 independent of ACE2.; Authors - Ke Wang
human	WB	Signal Transduct Target Ther; AHR mediates the aflatoxin B1 toxicity associated with hepatocellular carcinoma.; Authors - Qing Zhu
rat	WB	Bone Res; Sensory nerves directly promote osteoclastogenesis by secreting peptidyl-prolyl cis-trans isomerase D (Cyp40); Authors - Junqin Li
mouse,human	WB,IHC	Nat Commun; Induction of the hepatic aryl hydrocarbon receptor by alcohol dysregulates autophagy and phospholipid metabolism via PPP2R2D; Authors - Yun Seok Kim
		Redox Biol; The CYP1A-HSF1 axis alleviates mitochondrial oxidative stress to limit HBO-induced lung endothelial barrier damage.; Authors - Jing-Qian Huang
		J Nanobiotechnology; Self-adaptive nanozyme-loaded yeast microcapsules for multifunctional and precise therapy of colitis via intestinal microenvironment remodeling.; Authors - Wen Yin