CYP2A6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CYP2A6 Polyclonal antibody (21721-1-AP)

CYP2A6 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 21721-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Coumarin 7 hydroxylase, CYP2A, CYP2A3, CYP2A6, CYPIIA6, Cytochrome P450 2A6, Cytochrome P450 IIA3, Cytochrome P450(I), P450C2A, P450PB

• 

  WB analysis of mouse liver using 21721-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 21721-1-AP (CYP2A6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 21721-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21721-1-AP (CYP2A6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 21721-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21721-1-AP (CYP2A6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 21721-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 21721-1-AP (CYP2A6 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 21721-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 21721-1-AP (CYP2A6 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 21721-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 21721-1-AP (CYP2A6 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 21721-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 21721-1-AP (CYP2A6 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CYP2A6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse liver tissue, HepG2 cells, mouse lung tissue, rat liver tissue
• Positive IHC detected in: human liver tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21721-1-AP targets CYP2A6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16377

  Product name: Recombinant human CYP2A6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 198-494 aa of BC096253

  Sequence: FLSLLRMMLGIFQFTSTSTGQLYEMFSSVMKHLPGPQQQAFQLLQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFIGGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYMEAVIHEIQRFGDVIPMSLARRVKKDTKFRDFFLPKGTEVYPMLGSVLRDPSFFSNPQDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGLARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMSFLPR

• Full Name: cytochrome P450, family 2, subfamily A, polypeptide 6
• Calculated Molecular Weight: 494 aa, 57 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC096253
• Gene Symbol: CYP2A6
• Gene ID (NCBI): 1548
• RRID: AB_10791886
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11509
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-CYP2A6 antibody (Cat# 21721-1-AP) has 8 total citations across 7 unique publications. Citations appear in Acta Pharmacologica Sinica, Biochemical Pharmacology, Frontiers in Nutrition, Frontiers in Toxicology, Scientific Reports, Biochemical and Biophysical Research Communications, and Xenobiotica. Research fields span hepatocellular carcinoma, colon cancer drug resistance, renal fibrosis, atherosclerosis, neuroinflammation, breast cancer circadian biology, and cytochrome P450 drug metabolism.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Acta Pharmacol Sin; CYP2A6 suppresses hepatocellular carcinoma via inhibiting SRC/Wnt/β-Catenin pathway; Authors - Yi-Fan Liu
human	WB	Biochem Pharmacol; Drug resistance induces the upregulation of H2S-producing enzymes in HCT116 colon cancer cells.; Authors - Ashley A Untereiner
		Front Nutr; Asiatic acid from Centella asiatica alleviates renal fibrosis: coordinated modulation of the gut-kidney axis and retinol metabolism.; Authors - Liwei Zhu
mouse	WB	Front Toxicol; E-cigarette exposure causes early pro-atherogenic changes in an inducible murine model of atherosclerosis; Authors - Bayan Alakhtar
human	WB	Sci Rep; Extracellular vesicles released from macrophages modulates interleukin-1β in astrocytic and neuronal cells; Authors - Sunitha Kodidela
		Biochem Biophys Res Commun; Circadian rhythms in CYP2A5 expression underlie the time-dependent effect of tegafur on breast cancer; Authors - Yuya Yoshida