CYP46A1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CYP46A1 Polyclonal antibody (12486-1-AP)

CYP46A1 Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 12486-1-AP Copied!

Publications (21)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

CP46, Cholesterol 24S-hydroxylase, Cholesterol 24-monooxygenase, Cholesterol 24-hydroxylase, Cholesterol 24 hydroxylase

• 

  WB analysis using 12486-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12486-1-AP (CYP46A1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12486-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12486-1-AP (CYP46A1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 12486-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12486-1-AP (CYP46A1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 12486-1-AP

  IP result of anti-CYP46A1 (IP:12486-1-AP, 4ug; Detection:12486-1-AP 1:500) with mouse brain tissue lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 12486-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12486-1-AP (CYP46A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 12486-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12486-1-AP (CYP46A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 12486-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12486-1-AP (CYP46A1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 12486-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12486-1-AP (CYP46A1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 12486-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12486-1-AP (CYP46A1 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 12486-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12486-1-AP (CYP46A1 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 12486-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using CYP46A1 antibody (12486-1-AP) at dilution of 1:200 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CYP46A1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12486-1-AP targets CYP46A1 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3116

  Product name: Recombinant human CYP46A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 201-500 aa of BC022539

  Sequence: TSMLLGAQKPLSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQILKAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRGWQPAPPPPPC

• Full Name: cytochrome P450, family 46, subfamily A, polypeptide 1
• Calculated Molecular Weight: 500 aa, 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC022539
• Gene Symbol: CYP46A1
• Gene ID (NCBI): 10858
• RRID: AB_2090661
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6A2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytochrome P450 46A1 (CYP46A1), also named as CYP46, P450 46A1, CH24H and Cholesterol 24-hydroxylase, belongs to the cytochrome P450 family. CYP46A1 is a central nervous system-specific enzyme, and can freely cross the blood-brain barrier and be degraded in the liver. It is involved in the turnover of cholesterol. It converts cholesterol into 24S-hydroxycholesterol and, to a lesser extent, 25-hydroxycholesterol. CYP46A1 is significantly upregulated in hepatic lymphomyeloid cells compared with ESCs.(PMID:20039312)

Publications

What published studies show

The CYP46A1 Polyclonal antibody (Cat# 12486-1-AP) has accumulated 21 citations in journals including Nature Metabolism, Nature Communications, Theranostics, Advanced Science, Cell Reports Medicine, Oncogene, PLoS Biology, JCI Insight, EMBO Reports, and Neuroscience. Associated research fields encompass cholesterol metabolism, neuroinflammation, stroke, Alzheimer's and Parkinson's disease, glioma, Niemann-Pick disease, retinal injury, lipid metabolism, hemochromatosis, and breast cancer.

Automatically generated from the 21 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	Nat Metab; Cholesterol metabolic reprogramming mediates microglia-induced chronic neuroinflammation and hinders neurorestoration following stroke; Authors - Qiang Zhao
mouse	IF	Nat Commun; ATAD3A oligomerization promotes neuropathology and cognitive deficits in Alzheimer's disease models.; Authors - Yuanyuan Zhao
mouse	WB,IF	Theranostics; Alisol A ameliorates vascular cognitive impairment via AMPK/NAMPT/SIRT1-mediated regulation of cholesterol and autophagy.; Authors - Ping Xu
mouse	IF	Adv Sci (Weinh); Inhibition of SLC11A1-Mediated Lysosomal Iron Accumulation in Microglia Promotes Repair Following White Matter Stroke.; Authors - Lingling Qiu
human,mouse	WB,IHC	Cell Rep Med; Cholesterol 24-hydroxylase at the choroid plexus contributes to brain immune homeostasis; Authors - Afroditi Tsitsou-Kampeli
mouse	WB	Oncogene; Isocitrate dehydrogenase 1 mutation enhances 24(S)-hydroxycholesterol production and alters cholesterol homeostasis in glioma.; Authors - Risheng Yang