Home
Products
Primary Antibodies
CYP4A11 Polyclonal antibody, PBS Only (11688-1-PBS)

Filter: AllWBIHC

WB analysis of HEK-293 using 11688-1-AP (same clone as 11688-1-PBS)
HEK-293 cells were subjected to SDS PAGE followed by western blot with 11688-1-AP (CYP4A11 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11688-1-PBS in a different storage buffer formulation.
WB analysis of rat kidney using 11688-1-AP (same clone as 11688-1-PBS)
rat kidney tissue were subjected to SDS PAGE followed by western blot with 11688-1-AP (CYP4A11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11688-1-PBS in a different storage buffer formulation.
WB analysis of mouse kidney using 11688-1-AP (same clone as 11688-1-PBS)
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 11688-1-AP (CYP4A11 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11688-1-PBS in a different storage buffer formulation.
WB analysis of mouse kidney using 11688-1-AP (same clone as 11688-1-PBS)
mouse kidney tissue were subjected to SDS PAGE followed by western blot with 11688-1-AP (CYP4A11 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11688-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 11688-1-AP (same clone as 11688-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11688-1-AP (CYP4A11 antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11688-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 11688-1-AP (same clone as 11688-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 11688-1-AP (CYP4A11 antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11688-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 11688-1-AP (same clone as 11688-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 11688-1-AP (CYP4A11 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11688-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 11688-1-AP (same clone as 11688-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney using 11688-1-AP (CYP4A11 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11688-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 11688-1-AP (same clone as 11688-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 11688-1-AP (CYP4A11 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11688-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 11688-1-AP (same clone as 11688-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver using 11688-1-AP (CYP4A11 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11688-1-PBS in a different storage buffer formulation.

CYP4A11 Polyclonal antibody, PBS Only

Name: CYP4A11 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 11688-1-PBS

CYP4A11 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11688-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

20-HETE synthase, 20-hydroxyeicosatetraenoic acid synthase, CP4Y, CYP4A14, CYP4A2

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

11688-1-PBS targets CYP4A11 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2300 Product name: Recombinant human CYP4A11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC022851 Sequence: MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQFPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFRHWQRAQHSRHLP Predict reactive species
Full Name	cytochrome P450, family 4, subfamily A, polypeptide 11
Calculated Molecular Weight	519 aa, 59 kDa
Observed Molecular Weight	59 kDa
GenBank Accession Number	BC022851
Gene Symbol	CYP4A11
Gene ID (NCBI)	1579
RRID	AB_10804774
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q02928
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

CYP4A is a member of the CYP4 enzyme family and is involved in the metabolism of medium- and long-chain fatty acids, such as arachidonic acid, palmitate, laurate and compounds with highly regionally selective hydroxylated terminal ω-carbon (PMID: 2554928). CYP4A11 is involved in the development of nonalcoholic fatty liver disease via ROS-induced lipid peroxidation and inflammation (PMID: 32124935). CYP4A11 primarily metabolizes endobiotics and catalyzes the ω-hydroxylation of fatty acids in human liver and kidney tissues (PMID: 34594219). The human CYP4A11 is homologous to mouse CYP4A14 (PMID: 38356602).