CYP4B1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CYP4B1 Polyclonal antibody (11771-1-AP)

CYP4B1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 11771-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

CYP4B1, CYPIVB1, Cytochrome P450 4B1, Cytochrome P450 HP, P 450HP

• 

  WB analysis using 11771-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11771-1-AP (CYP4B1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 11771-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 11771-1-AP (CYP4B1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 11771-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 11771-1-AP (CYP4B1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 11771-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 11771-1-AP (CYP4B1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse lung using 11771-1-AP

  IP result of anti-CYP4B1 (IP:11771-1-AP, 4ug; Detection:11771-1-AP 1:500) with mouse lung tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 11771-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 11771-1-AP (CYP4B1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CYP4B1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse lung tissue, A549 cells, rat kidney tissue
• Positive IP detected in: mouse lung tissue
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1500
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11771-1-AP targets CYP4B1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2416

  Product name: Recombinant human CYP4B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 211-512 aa of BC017758

  Sequence: SYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNRRHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWPDPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKMPQLVLRSKNGFHLHLKPLGPGSGK

• Full Name: cytochrome P450, family 4, subfamily B, polypeptide 1
• Calculated Molecular Weight: 512 aa, 59 kDa
• Observed Molecular Weight: 55-59 kDa
• GenBank Accession Number: BC017758
• Gene Symbol: CYP4B1
• Gene ID (NCBI): 1580
• RRID: AB_11182944
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P13584
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The CYP4B1 Polyclonal antibody (Cat# 11771-1-AP) has 4 citations published in Mater Today Bio, Human Reproduction, Scientific Reports, and Journal of Endocrinological Investigation. The associated research fields include NSCLC immunotherapy via gene demethylation, inflammation and glycolysis in recurrent miscarriage, gut-ovary axis in PCOS, and TSH-mediated cardiac hypertrophy through the PI3K/AKT/CREB pathway. Applications span IHC and WB across mouse, human, and rat species.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Mater Today Bio; Integrating gene demethylation and immune modulation: PD-1 nanovesicles as a dual-action therapy for NSCLC; Authors - Heng Zhang
human	IHC	Hum Reprod; Single-cell profiling reveals mechanisms of uncontrolled inflammation and glycolysis in decidual stromal cell subtypes in recurrent miscarriage; Authors - Shihua Bao
rat	WB	Sci Rep; Gut-ovary axis and multiomic insights into PCOS in a DHEA-induced rat model.; Authors - Zhi Chen
rat	WB,IHC	J Endocrinol Invest; TSH upregulates CYP4B1 through the PI3K/AKT/CREB pathway to promote cardiac hypertrophy; Authors - Ziqi Han