CYP4B1 Polyclonal antibody

CYP4B1 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 11771-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

CYP4B1, CYPIVB1, Cytochrome P450 4B1, Cytochrome P450 HP, P 450HP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse lung tissue, A549 cells, rat kidney tissue
Positive IP detected inmouse lung tissue
Positive IHC detected inhuman lung cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1500
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11771-1-AP targets CYP4B1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2416

Product name: Recombinant human CYP4B1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 211-512 aa of BC017758

Sequence: SYYLAVSDLTLLMQQRLVSFQYHNDFIYWLTPHGRRFLRACQVAHDHTDQVIRERKAALQDEKVRKKIQNRRHLDFLDILLGARDEDDIKLSDADLRAEVDTFMFEGHDTTTSGISWFLYCMALYPEHQHRCREEVREILGDQDFFQWDDLGKMTYLTMCIKESFRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISMHIYALHRNSAVWPDPEVFDSLRFSTENASKRHPFAFMPFSAGPRNCIGQQFAMSEMKVVTAMCLLRFEFSLDPSRLPIKMPQLVLRSKNGFHLHLKPLGPGSGK

Predict reactive species
Full Name cytochrome P450, family 4, subfamily B, polypeptide 1
Calculated Molecular Weight 512 aa, 59 kDa
Observed Molecular Weight 55-59 kDa
GenBank Accession NumberBC017758
Gene Symbol CYP4B1
Gene ID (NCBI) 1580
RRIDAB_11182944
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP13584
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for CYP4B1 antibody 11771-1-APDownload protocol
IP protocol for CYP4B1 antibody 11771-1-APDownload protocol
WB protocol for CYP4B1 antibody 11771-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Hum Reprod

Single-cell profiling reveals mechanisms of uncontrolled inflammation and glycolysis in decidual stromal cell subtypes in recurrent miscarriage

Authors - Shihua Bao
ratWB,IHC

J Endocrinol Invest

TSH upregulates CYP4B1 through the PI3K/AKT/CREB pathway to promote cardiac hypertrophy

Authors - Ziqi Han
Loading...
||
New chat Able
正在加载,请稍候...