CYP51A1 Recombinant monoclonal antibody, PBS Only

CYP51A1 Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 84705-4-PBS
Clone No.242166G9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

242166G9, CP51, CYP51, CYPL1, CYPLI

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84705-4-PBS targets CYP51A1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4235

Product name: Recombinant human CYP51A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 146-509 aa of BC032322

Sequence: GKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSIIEKETKEYFESWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPVMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK

Predict reactive species
Full Name cytochrome P450, family 51, subfamily A, polypeptide 1
Calculated Molecular Weight 509 aa, 57 kDa
Observed Molecular Weight56 kDa
GenBank Accession NumberBC032322
Gene Symbol CYP51A1
Gene ID (NCBI) 1595
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ16850
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Lanosterol 14-alpha demethylase (cytochrome P450(51), CYP51A1) belongs to the evolutionarily conserved family of cytochrome P450 and catalyzes one of the key steps in cholesterol biosynthesis. CYP51A1 protein is targeted for degradation when exposed to nitric oxide generated under inflammatory conditions by NOS2 or released from NO donor compounds (PMID: 28830911). CYP51A1 is a prognostic marker in certain cancers, including Cervical squamous cell carcinoma, Head and neck squamous cell carcinoma, Kidney chromophobe, and Kidney renal clear cell carcinoma (PMID: 24711211).

Loading...
||
New chat Able
正在加载,请稍候...