CYP51A1 Recombinant monoclonal antibody

CYP51A1 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 84705-4-RR
Clone No.242166G9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

242166G9, CP51, CYP51, CYPL1, CYPLI

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HuH-7 cells, HEK-293 cells, RAW 264.7 cells, mouse testis tissue, rat liver tissue
Positive IHC detected inmouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84705-4-RR targets CYP51A1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4235

Product name: Recombinant human CYP51A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 146-509 aa of BC032322

Sequence: GKGVAYDVPNPVFLEQKKMLKSGLNIAHFKQHVSIIEKETKEYFESWGESGEKNVFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPVMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRSK

Predict reactive species
Full Name cytochrome P450, family 51, subfamily A, polypeptide 1
Calculated Molecular Weight 509 aa, 57 kDa
Observed Molecular Weight56 kDa
GenBank Accession NumberBC032322
Gene Symbol CYP51A1
Gene ID (NCBI) 1595
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ16850
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lanosterol 14-alpha demethylase (cytochrome P450(51), CYP51A1) belongs to the evolutionarily conserved family of cytochrome P450 and catalyzes one of the key steps in cholesterol biosynthesis. CYP51A1 protein is targeted for degradation when exposed to nitric oxide generated under inflammatory conditions by NOS2 or released from NO donor compounds (PMID: 28830911). CYP51A1 is a prognostic marker in certain cancers, including Cervical squamous cell carcinoma, Head and neck squamous cell carcinoma, Kidney chromophobe, and Kidney renal clear cell carcinoma (PMID: 24711211).

Protocols

Product Specific Protocols
WB protocol for CYP51A1 antibody 84705-4-RRDownload protocol
IHC protocol for CYP51A1 antibody 84705-4-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...