CYSLTR1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CYSLTR1 Polyclonal antibody, PBS Only (27372-1-PBS)

• 

  WB analysis using 27372-1-AP (same clone as 27372-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27372-1-AP (CYSLTR1 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27372-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 27372-1-AP (same clone as 27372-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 27372-1-AP (CYSLTR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27372-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 27372-1-AP (same clone as 27372-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 27372-1-AP (CYSLTR1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27372-1-PBS in a different storage buffer formulation.

CYSLTR1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27372-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

27372-1-PBS targets CYSLTR1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24961

  Product name: Recombinant human CYSLTR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 252-337 aa of BC035750

  Sequence: QRTIHLHFLHNETKPCDSVLTMQKSVVITLSLAASNCCFDPLLYFFSGGNFRKRLSTFRKHSLSSVTYVPRKKASLPEKGEEICKV

• Full Name: cysteinyl leukotriene receptor 1
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC035750
• Gene Symbol: CYSLTR1
• Gene ID (NCBI): 10800
• RRID: AB_2880856
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y271
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.