Cytohesin 1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Cytohesin 1 Polyclonal antibody (14217-1-AP)

Cytohesin 1 Polyclonal Antibody for WB, ELISA

Cat No. 14217-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CYTH1, CYTH 1, cytohesin1, Cytohesin-1

• 

  WB analysis using 14217-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14217-1-AP (Cytohesin 1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14217-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14217-1-AP (Cytohesin 1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Cytohesin 1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, Raji cells, K-562 cells, Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14217-1-AP targets Cytohesin 1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5455

  Product name: Recombinant human CYTH1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-398 aa of BC050452

  Sequence: MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH

• Full Name: cytohesin 1
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC050452
• Gene Symbol: Cytohesin 1
• Gene ID (NCBI): 9267
• RRID: AB_2088889
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15438
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Cytohesin 1 Polyclonal antibody (Cat# 14217-1-AP) has 1 total citation. It was cited in Nature Cell Biology (2019), in a study investigating the ARF6-Exportin-5 axis and its role in delivering pre-miRNA cargo to tumour microvesicles. The research falls within the fields of cell biology, RNA transport, and tumor biology.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Nat Cell Biol; An ARF6-Exportin-5 axis delivers pre-miRNA cargo to tumour microvesicles.; Authors - James W Clancy