CYTL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CYTL1 Polyclonal antibody, PBS Only (15856-1-PBS)

• 

  IHC staining of mouse lung using 15856-1-AP (same clone as 15856-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 15856-1-AP (CYTL1 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15856-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 15856-1-AP (same clone as 15856-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 15856-1-AP (CYTL1 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15856-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 15856-1-AP (same clone as 15856-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15856-1-AP (CYTL1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15856-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 15856-1-AP (same clone as 15856-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15856-1-AP (CYTL1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15856-1-PBS in a different storage buffer formulation.

CYTL1 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 15856-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

15856-1-PBS targets CYTL1 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3977

  Product name: Recombinant human CYTL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC031391

  Sequence: MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR

• Full Name: cytokine-like 1
• Calculated Molecular Weight: 16 kDa
• GenBank Accession Number: BC031391
• Gene Symbol: CYTL1
• Gene ID (NCBI): 54360
• RRID: AB_2292620
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NRR1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.