Calcipressin 1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Calcipressin 1 Polyclonal antibody, PBS Only (14869-1-PBS)

• 

  WB analysis using 14869-1-AP (same clone as 14869-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (Calcipressin 1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14869-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SKOV-3 cells using 14869-1-AP (same clone as 14869-1-PBS)

  WB result of RCAN1 antibody (14869-1-AP, 1:1000) with si-control and si-RCAN1 transfected SKOV-3 cells. This data was developed using the same antibody clone with 14869-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SKOV-3 using 14869-1-AP (same clone as 14869-1-PBS)

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14869-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 14869-1-AP (same clone as 14869-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14869-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 14869-1-AP (same clone as 14869-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14869-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse cerebellum using 14869-1-AP (same clone as 14869-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14869-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 14869-1-AP (same clone as 14869-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14869-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 14869-1-AP (same clone as 14869-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14869-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 14869-1-AP (same clone as 14869-1-PBS)

  IP result of anti-Calcipressin 1 (IP:14869-1-AP, 4ug; Detection:14869-1-AP 1:500) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 14869-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 14869-1-AP (same clone as 14869-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14869-1-AP (RCAN1 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 14869-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 14869-1-AP (same clone as 14869-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14869-1-AP (RCAN1 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 14869-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Calcipressin 1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 14869-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

14869-1-PBS targets Calcipressin 1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6457

  Product name: Recombinant human RCAN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-197 aa of BC002864

  Sequence: MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS

• Full Name: regulator of calcineurin 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 25-29 kDa
• GenBank Accession Number: BC002864
• Gene Symbol: RCAN1
• Gene ID (NCBI): 1827
• RRID: AB_10640904
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P53805
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.