Calnexin Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Calnexin Recombinant monoclonal antibody (81938-1-RR)

Calnexin Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 81938-1-RR Copied!

Clone No. 3K18

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CANX, 3K18, CNX, IP90, Major histocompatibility complex class I antigen-binding protein p88

• 

  WB analysis using 81938-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81938-1-RR (Calnexin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 81938-1-RR

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 81938-1-RR (Calnexin antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 81938-1-RR

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 81938-1-RR (Calnexin antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 81938-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Calnexin antibody (81938-1-RR, Clone: 3K18 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 81938-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Calnexin antibody (81938-1-RR, Clone: 3K18 ) at dilution of 1:2000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 81938-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81938-1-RR against Human Calnexin were performed. The affinity constant is 1.76 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Calnexin in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, MCF-7 cells, K-562 cells, NIH/3T3 cells, C6 cells
• Positive IHC detected in: human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81938-1-RR targets Calnexin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0697

  Product name: Recombinant human Calnexin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-273 aa of BC003552

  Sequence: MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPS

• Full Name: calnexin
• Calculated Molecular Weight: 90 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC003552
• Gene Symbol: Calnexin
• Gene ID (NCBI): 821
• RRID: AB_2935593
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P27824
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calnexin is a molecular chaperone that resides in the endoplasmic reticulum (ER) and participates in the folding and assembly of newly synthesized proteins. Calnexin is highly abundant in ER and is frequently used as an ER marker.

Publications

What published studies show

The Calnexin Recombinant monoclonal antibody (3K18), catalog number 81938-1-RR, has 12 total citations spanning 11 journals including Nature Communications, Advanced Science, Cardiovascular Diabetology, Journal for ImmunoTherapy of Cancer, Stem Cell Research & Therapy, and Scientific Reports. Research fields covered include liver disease and lipid metabolism, diabetic vascular calcification, colitis and neutrophil extracellular traps, checkpoint inhibitor pneumonitis, osteogenesis and bone repair, Wnt/β-catenin signaling, cardiac fibrosis, thyroid and nasopharyngeal cancer, and neural organoid generation.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nat Commun; Mic19 depletion impairs endoplasmic reticulum-mitochondrial contacts and mitochondrial lipid metabolism and triggers liver disease; Authors - Jun Dong
human	WB	Cardiovasc Diabetol; Endothelial cells derived extracellular vesicles promote diabetic arterial calcification via circ_0008362/miR-1251-5p/Runx2 axial; Authors - Xiao Lin
		Adv Sci (Weinh); IL-7R-Enriched Extracellular Vesicles From the Thymus Drive Colitis via Promoting Neutrophil Extracellular Trap Formation.; Authors - Yao Liao
human	WB	J Immunother Cancer; Novel circulating microRNA signature for early detection and prognostication of checkpoint inhibitor-related pneumonitis.; Authors - Haiyi Deng
rat	WB	Stem Cell Res Ther; Exosomes derived from umbilical cord mesenchymal stem cells alleviate jaw bone marrow mesenchymal stem cells senescence and restore osteogenic differentiation potential.; Authors - Hongkun Li
		Stem Cell Rev Rep; Extracellular Vesicles Derived from Resveratrol-Treated BMSCs Promote the Repair of Bone Defects in Osteoporotic Rats.; Authors - Yan Lv