Calpain 11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Calpain 11 Polyclonal antibody, PBS Only (13675-1-PBS)

• 

  WB analysis of PC-3 using 13675-1-AP (same clone as 13675-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 13675-1-AP (Calpain 11 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13675-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 13675-1-AP (same clone as 13675-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 13675-1-AP (Calpain 11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13675-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13675-1-AP (same clone as 13675-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using Calpain 11 antibody (13675-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). This data was developed using the same antibody clone with 13675-1-PBS in a different storage buffer formulation.

Calpain 11 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13675-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

EC:3.4.22.-, CAPN11, CANP 11, Calpain-11, calpain11

---

Product Information

13675-1-PBS targets Calpain 11 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4668

  Product name: Recombinant human CAPN11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 352-702 aa of BC033733

  Sequence: YWHTTFYEGSWRRGSSAGGCRNHPGTFWTNPQFKISLPEGDDPEDDAEGNVVACTCLVALMQKNWRHARQQGAQLQTIGFVLYAVPKEFQNIQDVHLKKEFFTKYQDHGFSEIFTNSREVSSQLRLPPGEYIIIPSTFEPHRDADFLLRVFTEKHSESWELDEVNYAEQLQEEKVSEDDMDQDFLHLFKIVAGEGKEIGVYELQRLLNRMAIKFKSFKTKGFGLDACRCMINLMDKDGSGKLGLLEFKILWKKLKKWMDIFRECDQDHSGTLNSYEMRLVIEKAGIKLNNKVMQVLVARYADDDLIIDFDSFISCFLRLKTMFTFFLTMDPKNTGHICLSLEQWLQMTMWG

• Full Name: calpain 11
• Calculated Molecular Weight: 702 aa, 81 kDa
• Observed Molecular Weight: 81 kDa
• GenBank Accession Number: BC033733
• Gene Symbol: Calpain 11
• Gene ID (NCBI): 11131
• RRID: AB_2069480
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UMQ6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calpains are a superfamily of related proteins, some of which have been shown to function as intracellular calcium-dependent cysteine proteases. Calpains consist of a variable large (80 kDa) subunit and an invariant small (30 kDa) subunit. The expression of calpain11 during spermatogenesis and its localization is spermatozoa suggest that it is involved in regulating calcium-dependent signal transduction events during meiosis and sperm functional processes(PMID:16541461). And the 110 kDa band protein may be regarded as a complex.