Calpain 15/SOLH Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Calpain 15/SOLH Polyclonal antibody (33924-1-AP)

• 

  WB analysis using 33924-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33924-1-AP (Calpain 15/SOLH antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

Calpain 15/SOLH Polyclonal Antibody for WB, ELISA

Cat No. 33924-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Calpain 15, Calpain15, Calpain-15, CAPN15, EC:3.4.22.-

---

Tested Applications

• Positive WB detected in: Jurkat cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33924-1-AP targets Calpain 15/SOLH in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40689

  Product name: Recombinant human SOLH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-150 aa of BC021854

  Sequence: MATVGEWSCVRCTFLNPAGQRQCSICEAPRHKPDLNHILRLSVEEQKWPCARCTFRNFLGKEACEVCGFTPEPAPGAAFLPVLNGVLPKPPAILGEPKGSCQEEAGPVRTAGLVATEPARGQCEDKDEEEKEEQEEEEGAAEPRGGWACP

• Full Name: small optic lobes homolog (Drosophila)
• Calculated Molecular Weight: 117 kDa
• Observed Molecular Weight: 117 kDa
• GenBank Accession Number: BC021854
• Gene Symbol: SOLH
• Gene ID (NCBI): 6650
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75808
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Calpain 15 (also known as CAPN15 and SOLH) is an intracellular cysteine protease belonging to the non-classical small optic lobe (SOL) family of calpains, which plays an important role in developmental processes (PMID: 40238785). Capn15 is expressed at much higher levels during early neuronal development than in the adult (PMID: 32885237). And loss of Capn15 in forebrain excitatory neurons leads to some behavioral deficits including decreased fear generalization (PMID: 37598906).