Calsequestrin 2 Polyclonal antibody, PBS Only

• 

  WB analysis of human heart using 18422-1-AP (same clone as 18422-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 18422-1-AP (Calsequestrin 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 18422-1-AP (same clone as 18422-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18422-1-AP (Calsequestrin 2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 18422-1-AP (same clone as 18422-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 18422-1-AP (Calsequestrin 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 18422-1-AP (same clone as 18422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 18422-1-AP (Calsequestrin 2 antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 18422-1-AP (same clone as 18422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 18422-1-AP (Calsequestrin 2 antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 18422-1-AP (same clone as 18422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 18422-1-AP (Calsequestrin 2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 18422-1-AP (same clone as 18422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 18422-1-AP (Calsequestrin 2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 18422-1-AP (same clone as 18422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen using 18422-1-AP (Calsequestrin 2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 18422-1-AP (same clone as 18422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 18422-1-AP (Calsequestrin 2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 18422-1-AP (same clone as 18422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 18422-1-AP (Calsequestrin 2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 18422-1-AP (same clone as 18422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 18422-1-AP (Calsequestrin 2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 18422-1-AP (same clone as 18422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 18422-1-AP (Calsequestrin 2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 18422-1-AP (same clone as 18422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 18422-1-AP (Calsequestrin 2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 18422-1-AP (same clone as 18422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta using 18422-1-AP (Calsequestrin 2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 18422-1-AP (same clone as 18422-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 18422-1-AP (Calsequestrin 2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• 

  IF Staining of C2C12 using 18422-1-AP (same clone as 18422-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed C2C12 cell using 18422-1-AP (Calsequestrin 2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 18422-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Calsequestrin 2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 18422-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

18422-1-PBS targets Calsequestrin 2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13246

  Product name: Recombinant human CASQ2 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-399 aa of BC022288

  Sequence: MKRTHLFIVGIYFLSSCRAEEGLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE

• Full Name: calsequestrin 2 (cardiac muscle)
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC022288
• Gene Symbol: Calsequestrin 2
• Gene ID (NCBI): 845
• RRID: AB_2071473
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14958
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Calsequestrin (CASQ) is a Ca2+-binding protein present primarily in junctional sarcoplasmic reticulum of skeletal and cardiac muscle; the cardiac form (CASQ2) is encoded by a separate gene. The primary role of CASQ2 is buffering of the sarcoplasmic reticulum Ca2+ ions, but another role for CASQ2 has emerged recently: CASQ2 regulates the open probability of ryanodine receptor 2 (RyR2). Mutations in CASQ2 cause stress-induced polymorphic ventricular tachycardia, also referred to as catecholaminergic polymorphic ventricular tachycardia 2 (CPVT2), a disease characterized by bidirectional ventricular tachycardia that may lead to cardiac arrest.