Cannabinoid receptor 2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Cannabinoid receptor 2 Polyclonal antibody, PBS Only (29371-1-PBS)

• 

  WB analysis of MCF-7 using 29371-1-AP (same clone as 29371-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 29371-1-AP (Cannabinoid receptor 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29371-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29371-1-AP (same clone as 29371-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29371-1-AP (Cannabinoid receptor 2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29371-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 29371-1-AP (same clone as 29371-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29371-1-AP (Cannabinoid receptor 2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29371-1-PBS in a different storage buffer formulation.

Cannabinoid receptor 2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29371-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

CNR2, CB2B, CB2A, CB-2, CB2

---

Product Information

29371-1-PBS targets Cannabinoid receptor 2 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30609

  Product name: Recombinant human CNR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-59 aa of BC074767

  Sequence: MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLIL

• Full Name: cannabinoid receptor 2 (macrophage)
• Calculated Molecular Weight: 360 aa, 40 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC074767
• Gene Symbol: Cannabinoid receptor 2
• Gene ID (NCBI): 1269
• RRID: AB_2918285
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P34972
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cannabinoid receptor 1 (CNR1, or CB1) and CNR2 (CB2) are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family. The CB1 receptor is expressed mainly in the brain. The CB2 receptor is expressed mainly in the immune system and in hematopoietic cells. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana.