Cardiac Troponin T Polyclonal antibody

• 

  WB analysis using 26592-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26592-1-AP (Cardiac Troponin T antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 26592-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 26592-1-AP (Cardiac Troponin T antibody at dilution of 1:500 (under 10x lens).

• 

  IHC staining of human heart using 26592-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 26592-1-AP (Cardiac Troponin T antibody at dilution of 1:500 (under 40x lens).

• 

  IHC staining of mouse heart using 26592-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 26592-1-AP (Cardiac Troponin T antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 26592-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 26592-1-AP (Cardiac Troponin T antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse heart using 26592-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using 26592-1-AP (Cardiac Troponin T antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of mouse heart using 26592-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using Cardiac Troponin T antibody (26592-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Cardiac Troponin T Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 26592-1-AP

Publications(9)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

Synonyms

Cardiac muscle troponin T, Cardiac Troponin T, CMH2, CMPD2, cTnT, RCM3, TNNT2, TnTC, troponin T type 2 (cardiac), Troponin T, cardiac muscle

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat heart tissue
• Positive IHC detected in: human heart tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below
• IF: See 7 publications below

Product Information

26592-1-AP targets Cardiac Troponin T in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24911

  Product name: Recombinant human cTnT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-76 aa of BC002653

  Sequence: MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVP

• Full Name: troponin T type 2 (cardiac)
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 34-40 kDa
• GenBank Accession Number: BC002653
• Gene Symbol: Cardiac Troponin T
• Gene ID (NCBI): 7139
• RRID: AB_2880566
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P45379
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Biomaterials; Targeted immunomodulation therapy for cardiac repair by platelet membrane engineering extracellular vesicles via hitching peripheral monocytes.; Authors - Qiyu Li
human	IF	Free Radic Biol Med; SIRT3 promotes metabolic maturation of human iPSC-derived cardiomyocytes via OPA1-controlled mitochondrial dynamics; Authors - Rui Wang
mouse	IHC	Front Physiol; The physiological response during optogenetic-based cardiac pacing in awake freely moving mice; Authors - Jun Kaminosono
mouse	IF	Clin Exp Hypertens; Exploration and validation of signature genes and immune associations in septic cardiomyopathy; Authors - Zhengbo Zhao
human,mouse	IF	Signal Transduct Target Ther; Thiamine-modified metabolic reprogramming of human pluripotent stem cell-derived cardiomyocyte under space microgravity; Authors - Xinglong Han
mouse	IF	Nat Commun; Fibroblast-specific PRMT5 deficiency suppresses cardiac fibrosis and left ventricular dysfunction in male mice; Authors - Yasufumi Katanasaka