Tested Applications
| Positive IF-P detected in | mouse heart tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL488-26592 targets Cardiac Troponin T in IF-P applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24911 Product name: Recombinant human cTnT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC002653 Sequence: MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVP Predict reactive species |
| Full Name | troponin T type 2 (cardiac) |
| Calculated Molecular Weight | 36 kDa |
| Observed Molecular Weight | 34-40 kDa |
| GenBank Accession Number | BC002653 |
| Gene Symbol | Cardiac Troponin T |
| Gene ID (NCBI) | 7139 |
| RRID | AB_3084097 |
| Conjugate | CoraLite® Plus 488 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 493 nm / 522 nm |
| Excitation Laser | Blue laser (488 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P45379 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Cardiac Troponin T, also named as cTnT, TNNT2. This gene encodes the cardiac isoform of troponin T. The encoded protein is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. cTnT is commonly used as a marker of cardiomyogenic differentiation; in H9C2 rat cardiomyoblasts, its expression typically increases upon differentiation induction. Similar to H9C2, immortalized cardiomyocyte cell lines such as AC16 and HL-1 also show changes in the expression of cardiac markers (e.g., cTnT/TNNT2) upon differentiation induction-cardiac markers increase significantly in differentiated AC16 and H9C2 cells, whereas HL-1 already possesses a certain degree of sarcomeric structure-yet none of the three can fully recapitulate the transcriptomic and functional phenotypes of mature cardiomyocytes. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Cardiac Troponin T can be detected as about 34-40 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL Plus 488 Cardiac Troponin T antibody CL488-26592 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Cardiac Troponin T Polyclonal antibody (CL488-26592, CoraLite® Plus 488 conjugated) has 1 citation to date. It was cited in Nature Communications (IF 18.1) in a 2025 study on programmable production of bioactive extracellular vesicles in vivo to treat myocardial infarction. The antibody was used for immunofluorescence (IF) in this cardiovascular research context, supporting its application in studying cardiac-related extracellular vesicle biology.
| Species | Application | Title |
|---|---|---|
Nat Commun Programmable production of bioactive extracellular vesicles in vivo to treat myocardial infarction |
