Caspase 1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Caspase 1 Polyclonal antibody (31020-1-AP)

Caspase 1 Polyclonal Antibody for WB, ELISA

Cat No. 31020-1-AP Copied!

Publications (104)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

Casp1, m CASP1, mouse CASP1, mouse caspase 1, CASP 1

• 

  WB analysis using 31020-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31020-1-AP (Casp1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 31020-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31020-1-AP (Caspase 1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Caspase 1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse heart tissue, human skeletal muscle tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue, rat heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31020-1-AP targets Caspase 1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34441

  Product name: Recombinant mouse Casp1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 119-296 aa of P29466

  Sequence: DNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFK

• Full Name: caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: P29466
• Gene Symbol: Caspase 1
• Gene ID (NCBI): 834
• RRID: AB_3669817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P29466
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CASP1(caspase-1) is also named as IL1BC, IL1BCE and belongs to the peptidase C14A family. It is a cysteine protease that regulates inflammatory processes through its capacity to process and activate the interleukin-1-beta (IL1B), IL18, and IL33 precursor proteins. The active caspase-1 can increase cellular membrane permeability and intracellular calcium levels, which facilitates lysosome exocytosis and release of host antimicrobial factors and microbial products (PMID:21804020).

Publications

What published studies show

The Caspase 1 polyclonal antibody (Cat# 31020-1-AP) has accumulated 104 citations published in over 60 journals, including Redox Biology, Phytomedicine, International Immunopharmacology, Journal of Nanobiotechnology, Free Radical Biology and Medicine, Journal of Controlled Release, and PLoS ONE. Associated research fields encompass pyroptosis and inflammasome signaling, neuroinflammation and neurodegeneration, cardiovascular disease, hepatic and renal injury, inflammatory bowel disease, oncology, nanomedicine, traditional Chinese medicine pharmacology, environmental toxicology, and bone/joint disorders.

Automatically generated from the 104 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	J Adv Res; Ginsenoside Rh1 ameliorates polystyrene nanoplastics-caused vascular injury by regulating HSP70 to suppress endoplasmic reticulum stress and pyroptosis.; Authors - Yue-qin Song
mouse	WB,IF	Redox Biol; PHGDH-dependent serine metabolism in astrocytes: A key regulator of oxidative stress and pyroptosis in cerebral ischemia-reperfusion injury.; Authors - Jimeng Zhang
mouse	WB	Redox Biol; Redox-modulating macrophage biohybrid nanoplatform for targeted RIPK1-PANoptosome suppression in ischemic stroke.; Authors - Wenhui Jiang
rat,mouse	WB,IF	J Nanobiotechnology; An injectable dihydroartemisinin nanocomposite hydrogel for dual-targeting PANoptosis and inflammation to treat osteoarthritis.; Authors - Qingchen Li
mouse	WB	J Nanobiotechnology; HIFU postoperative hypoxia-activated metal-organic frameworks modulate the tumor microenvironment to augment immunotherapy.; Authors - Chengyan Luo
mouse	WB	Acta Pharm Sin B; Extracellular vesicles-derived hybrid biomimetic nanoplatforms camouflaged Golgi apparatus-targeted aggregation induced emission photosensitizer to elicit pyroptosis and immunogenic cell death for efficient antitumor photoimmunotherapy.; Authors - Xing Zhao