• Featured Product
  • KD/KO Validated

Caspase 1 Recombinant monoclonal antibody, PBS Only

Caspase 1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 81482-1-PBS
Clone No.1O18

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

CASP1, Caspase1, 1O18, CASP 1, CASP-1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81482-1-PBS targets Caspase 1 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag11143

Product name: Recombinant human Caspase 1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-311 aa of BC062327

Sequence: MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

Predict reactive species
Full Name caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)
Calculated Molecular Weight 404 aa, 45 kDa
Observed Molecular Weight30 kDa, 35 kDa, 43-45 kDa
GenBank Accession NumberBC062327
Gene Symbol Caspase 1
Gene ID (NCBI) 834
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP29466
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CASP1(caspase-1) is also named as IL1BC, IL1BCE and belongs to the peptidase C14A family. It is a cysteine protease that regulates inflammatory processes through its capacity to process and activate the interleukin-1-beta (IL1B), IL18, and IL33 precursor proteins. The active caspase-1 can increase cellular membrane permeability and intracellular calcium levels, which facilitates lysosome exocytosis and release of host antimicrobial factors and microbial products (PMID:21804020). It has 5 isoforms produced by alternative splicing. 81482-1-RR can recognize the 45 kDa Pro-Caspase1 and the 30-35 kDa splicing isoforms or active dimer form of caspase 1.

Loading...
||
New chat Able
正在加载,请稍候...