Caspase 1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Caspase 1 Recombinant monoclonal antibody (81482-1-RR)

• Featured Product
• KD/KO Validated

Caspase 1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 81482-1-RR Copied!

Clone No. 1O18

Publications (76)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

CASP1, Caspase1, CASP 1, CASP-1, Caspase-1

• 

  WB analysis using 81482-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81482-1-RR (Caspase 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Affinity and Kinetic Characterization of 81482-1-RR

  Biolayer interferometry (BLl) kinetic assays of 81482-1-RR against Human Caspase 1 were performed. The affinity constant is 305 nM.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Caspase 1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Raji cells, THP-1 cells, U-937 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81482-1-RR targets Caspase 1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag11143

  Product name: Recombinant human Caspase 1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-311 aa of BC062327

  Sequence: MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

• Full Name: caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)
• Calculated Molecular Weight: 404 aa, 45 kDa
• Observed Molecular Weight: 30 kDa, 35 kDa, 43-45 kDa
• GenBank Accession Number: BC062327
• Gene Symbol: Caspase 1
• Gene ID (NCBI): 834
• RRID: AB_2935555
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P29466
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CASP1(caspase-1) is also named as IL1BC, IL1BCE and belongs to the peptidase C14A family. It is a cysteine protease that regulates inflammatory processes through its capacity to process and activate the interleukin-1-beta (IL1B), IL18, and IL33 precursor proteins. The active caspase-1 can increase cellular membrane permeability and intracellular calcium levels, which facilitates lysosome exocytosis and release of host antimicrobial factors and microbial products (PMID:21804020). It has 5 isoforms produced by alternative splicing. 81482-1-RR can recognize the 45 kDa Pro-Caspase1 and the 30-35 kDa splicing isoforms or active dimer form of caspase 1.

Publications

What published studies show

The Caspase 1 Recombinant monoclonal antibody (Cat# 81482-1-RR) has accumulated 76 citations across 56 journals, including Nature Communications, Advanced Science, Cell Reports Medicine, Journal of Controlled Release, Phytomedicine, Acta Biomaterialia, Frontiers in Immunology, International Immunopharmacology, and Biochemical Pharmacology. Key research fields include pyroptosis and NLRP3 inflammasome signaling, ischemia-reperfusion injury (myocardial, cerebral, intestinal), neuroinflammation, cancer, kidney and lung injury, diabetes complications, gut microbiota, and wound healing. Applications are predominantly Western blot, supplemented by IHC, IF, and ELISA.

Automatically generated from the 76 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nat Commun; Prussian blue nanoparticles targeting multiple PANoptosome-mediated PANoptosis for myocardial ischemia-reperfusion injury therapy.; Authors - Lingling Xu
	WB	Redox Biol; Histone H3K9 lactylation activates the TXNIP/NLRP3 pathway to drive macrophage inflammation after spinal cord injury.; Authors - Chaoran Shi
	WB	Adv Sci (Weinh); Tailored Porous Bimetallic Nanozyme Platform for Full-Cycle Therapeutics of Intestinal Ischemia/Reperfusion.; Authors - Chenghao Qiu
human	WB	Adv Sci (Weinh); Scutellarin Rescued Mitochondrial Damage through Ameliorating Mitochondrial Glucose Oxidation via the Pdk-Pdc Axis; Authors - Ning Sheng
		Adv Sci (Weinh); Engineering a 660 nm-Responsive Optogenetic Inducer of Pyroptosis for Precision Cancer Therapy.; Authors - Mengkai Zhang
		Cell Rep Med; The direct and indirect inhibition of proinflammatory adipose tissue macrophages by acarbose in diet-induced obesity; Authors - Xiaohui Li