Caspase 2/P32/P18 Monoclonal antibody, PBS Only (Detector)

Caspase 2/P32/P18 Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 66517-1-PBS
Clone No.2G4C2

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Cytometric bead array, Indirect ELISA

CASP2, Caspase 2, 2G4C2, CASP 2, CASP-2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66517-1-PBS targets Caspase 2/P32/P18 as part of a matched antibody pair:

MP50435-1: 66517-2-PBS capture and 66517-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20141

Product name: Recombinant human Caspase 2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 170-325 aa of BC002427

Sequence: GPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDET

Predict reactive species
Full Name caspase 2, apoptosis-related cysteine peptidase
Calculated Molecular Weight 452 aa, 51 kDa
Observed Molecular Weight48-51 kDa, 32 kDa, 18 kDa
GenBank Accession NumberBC002427
Gene Symbol Caspase 2
Gene ID (NCBI) 835
RRIDAB_2881880
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP42575
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CASP2(Caspase-2) is also named as ICH1, NEDD2 and belongs to the peptidase C14A family.It is involved in the activation cascade of caspases responsible for apoptosis execution and might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival.It has 2 isoforms produced by alternative splicing and can exists almost as a dimer in solution(PMID:15865942).This antibody can recognize the 32 kDa pro-caspase 2 as well as 18 kDa cleaved-caspase 2.

Loading...
||
New chat Able
正在加载,请稍候...