Caspase 7 Monoclonal antibody, PBS Only

Caspase 7 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 67956-1-PBS
Clone No.3C9H4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Apoptotic protease Mch 3, CASP 7, CASP7, Caspase 7, Caspase7, CMH 1, ICE LAP3, ICE like apoptotic protease 3, MCH3

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67956-1-PBS targets Caspase 7 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27601

Product name: Recombinant human Caspase 7 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-100 aa of BC015799

Sequence: MADEQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKC

Predict reactive species
Full Name caspase 7, apoptosis-related cysteine peptidase
Calculated Molecular Weight 303 aa, 34 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC015799
Gene Symbol Caspase 7
Gene ID (NCBI) 840
RRIDAB_2918707
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP55210
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Caspase 7(CASP7), like caspases 3 and 6, contains a short prodomain and, upon apoptotic induction, the 35 kDa proform is converted into a 32 kDa intermediate or preactive form which is further processed into two active subunits consisting of the p20 or large (18 kDa) subunit and the p10 or small (11 kDa) subunit and it is present in the brain, which is up-regulated and activated after traumatic injury(PMID:15953353). Caspase-7 is classified as a member of the subgroup of cysteine proteases most related to the Caenorhabditis elegans factor CED-3, which also includes caspase-3, -6, and -9(PMID:9426061). The protein is involved in the activation cascade of caspases responsible for apoptosis execution.

Loading...
||
New chat

Able

正在加载,请稍候...