Mouse Cathepsin B Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85841-5-RR (same clone as 85841-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85841-5-RR (Cathepsin B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85841-5-PBS in a different storage buffer formulation.

• 

  WB analysis using 85841-5-RR (same clone as 85841-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85841-5-RR (Cathepsin B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85841-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 85841-5-RR (same clone as 85841-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85841-5-RR (Cathepsin B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85841-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 85841-5-RR (same clone as 85841-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 85841-5-RR (Cathepsin B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85841-5-PBS in a different storage buffer formulation.

• 

  IF Staining of RAW 264.7 using 85841-5-RR (same clone as 85841-5-PBS)

  Immunofluorescent analysis of (4% PFA) fixed RAW 264.7 cells using Cathepsin B antibody (85841-5-RR, Clone: 243020A5 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 85841-5-PBS in a different storage buffer formulation.

• 

  FC experiment of RAW 264.7 using 85841-5-RR (same clone as 85841-5-PBS)

  1x10^6 RAW 264.7 cells were intracellularly stained with 0.25 ug Cathepsin B Recombinant antibody (85841-5-RR, Clone:243020A5) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 85841-5-PBS in a different storage buffer formulation.

Cathepsin B Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 85841-5-PBS

Clone No.243020A5

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

Cathepsin B heavy chain, Cathepsin B light chain, Cathepsin B1, Ctsb, EC:3.4.22.1

---

Product Information

85841-5-PBS targets Cathepsin B in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3028

  Product name: Recombinant Mouse Ctsb protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 18-339 aa of NM_007798.3

  Sequence: HDKPSFHPLSDDLINYINKQNTTWQAGRNFYNVDISYLKKLCGTVLGGPKLPGRVAFGEDIDLPETFDAREQWSNCPTIGQIRDQGSCGSCWAFGAVEAISDRTCIHTNGRVNVEVSAEDLLTCCGIQCGDGCNGGYPSGAWSFWTKKGLVSGGVYNSHVGCLPYTIPPCEHHVNGSRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGVENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIPRTDQYWGRF

• Full Name: cathepsin B
• Calculated Molecular Weight: 37 kDa
• Observed Molecular Weight: 31 kDa, 39 kDa
• GenBank Accession Number: NM_007798.3
• Gene Symbol: Ctsb
• Gene ID (NCBI): 13030
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10605
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CTSB(Cathepsin B) is also named as CPSB and belongs to the peptidase C1 family. It participates in intracellular degradation and turnover of proteins. Cathepsin B precursors found in human malignant ascites fluid do not possess mannose-rich carbohydrates suggesting that a defect in the post translational processing of carbohydrate moieties on tumor. Cathepsin B exists as both glycosylated and unglycosylated forms(PMID:1637335). In rat macrophages and hepatocytes pro- cathepsin B is 39 kDa (unglycosylated =35 kDa), whereas in human fibroblasts procathepsin B is 44.5-46kDa (unglycosylated=39kDa)(PMID:2097084). It can be detected the 39 kDa form of pro-CTSB, 31 kDa mature forms in mouse brain by western blot.