• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated Caveolin-1 Monoclonal antibody

Caveolin-1 Monoclonal Antibody for IF-P, FC (Intra)

Cat No. CL594-66067
Clone No.6C2B2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF-P, FC (Intra)

CAV1, Caveolin 1, 6C2B2, BSCL3, CAV

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inhuman liver cancer tissue, human skin cancer tissue
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL594-66067 targets Caveolin-1 in IF-P, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivitymouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8049

Product name: Recombinant human Caveolin-1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 11-179 aa of BC006432

Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Predict reactive species
Full Name caveolin 1, caveolae protein, 22kDa
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 20-25 kDa
GenBank Accession NumberBC006432
Gene Symbol CAV1
Gene ID (NCBI) 857
RRIDAB_2883501
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ03135
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Caveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in gastric cancer (PMID: 25339030).

Protocols

Product Specific Protocols
FC protocol for CL594 Caveolin-1 antibody CL594-66067Download protocol
IF protocol for CL594 Caveolin-1 antibody CL594-66067Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Mutat Res

Downregulated CAV-1 in mouse spinal cord may alleviate bone cancer pain by inhibiting the ERK/CREB pathway

Authors - Jianyun Ge
Loading...
||
New chat

Able

正在加载,请稍候...