Centrin 2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Centrin 2 Polyclonal antibody, PBS Only (15877-1-PBS)

• 

  WB analysis using 15877-1-AP (same clone as 15877-1-PBS)

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 15877-1-AP (Centrin 2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15877-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15877-1-AP (same clone as 15877-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15877-1-AP (Centrin 2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15877-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15877-1-AP (same clone as 15877-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15877-1-AP (Centrin 2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15877-1-PBS in a different storage buffer formulation.

Centrin 2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15877-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15877-1-PBS targets Centrin 2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8638

  Product name: Recombinant human Centrin 2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC005334

  Sequence: MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY

• Full Name: centrin, EF-hand protein, 2
• Calculated Molecular Weight: 172 aa, 20 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC005334
• Gene Symbol: Centrin 2
• Gene ID (NCBI): 1069
• RRID: AB_2077383
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P41208
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Centrin 2 is also named as CALT, or CEN2. It plays a fundamental role in microtubule-organizing center structure and function. Oxidizing radiation induces polymerization of centrin 2 into dimers, tetramers, hexamers,and even higher molecular mass species, as a function of the radiation dose(PMID:17603931).It exsits as a 21-kD polypeptide specifically localized to the centrosome of interphase and mitotic cells in both HeLa and BHK cells (PMID:8248209).