CoraLite® Plus 488-conjugated Ch-TOG Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-84285-3

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite® Plus 488 Ch-TOG antibody (CL488-84285-3, Clone: 241546G8 ) at dilution of 1:200.

Ch-TOG Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-84285-3

Clone No.241546G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

CKAP5, 241546G8, ch TOG, Colonic and hepatic tumor overexpressed gene protein, Cytoskeleton-associated protein 5

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84285-3 targets Ch-TOG in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24875

  Product name: Recombinant human CKAP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-349 aa of BC120869

  Sequence: MGDDSEWLKLPVDQKCEHKLWKARLSGYEEALKIFQKIKDEKSPEWSKFLGLIKKFVTDSNAVVQLKGLEAALVYVENAHVAGKTTGEVVSGVVSKVFNQPKAKAKELGIEICLMYIEIEKGEAVQEELLKGLDNKNPKIIVACIETLRKALSEFGSKIILLKPIIKVLPKLFESREKAVRDEAKLIAVEIYRWIRDALRPPLQNINSVQLKELEEEWVKLPTSAPRPTRFLRSQQELEAKLEQQQSAGGDAEGGGDDGDEVPQIDAYELLEAVEILSKLPKDFYDKIEAKKWQERKEALESVEVLIKNPKLEAGDYADLVKALKKVVGKDTNVMLVALAAKCLTGLAV

• Full Name: cytoskeleton associated protein 5
• Observed Molecular Weight: 220 kDa
• GenBank Accession Number: BC120869
• Gene Symbol: Ch-TOG
• Gene ID (NCBI): 9793
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q14008
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Ch-TOG (colonic hepatic tumor-overexpressed gene), also known as XMAP215 or CKAP5, is a microtubule polymerase which can promotes cytoplasmic microtubule nucleation and elongation. Through interacting with Aurora-A and TACC3, it plays a major role in organizing spindle poles.