Tested Applications
| Positive WB detected in | ACHN cells, pig skin tissue, Caki-1 cells, HaCaT cells, HepG2 cells, HT-1376 cells, rat skin tissue, mouse skin tissue |
| Positive IF/ICC detected in | HaCaT cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
68969-4-Ig targets Claudin 1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29478 Product name: Recombinant human Claudin 1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 102-211 aa of BC012471 Sequence: MKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV Predict reactive species |
| Full Name | claudin 1 |
| Calculated Molecular Weight | 211 aa, 23 kDa |
| Observed Molecular Weight | 20-23 kDa |
| GenBank Accession Number | BC012471 |
| Gene Symbol | Claudin 1 |
| Gene ID (NCBI) | 9076 |
| RRID | AB_3743321 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O95832 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 23 claudins have been identified. They are small (20-27 kilodalton (kDa)) proteins with similar structures. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. Claudin-1 is an integral membrane protein expressed primarily in keratinocytes and normal mammary epithelial cells. Claudin 1 forms tight junctions with other claudin proteins and plays an important role in the intestinal epithelial barrier.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Claudin 1 antibody 68969-4-Ig | Download protocol |
| WB protocol for Claudin 1 antibody 68969-4-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





