Claudin 1 Monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Claudin 1 Monoclonal antibody, PBS Only (68969-4-PBS)

Claudin 1 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68969-4-PBS

Clone No.2D6F6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

Caudin 1, CLDN1, Claudin-1, CLD1, ILVASC

• 

  WB analysis using 68969-4-Ig (same clone as 68969-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68969-4-Ig (Claudin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68969-4-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 68969-4-Ig (same clone as 68969-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68969-4-Ig (Claudin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68969-4-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HaCaT using 68969-4-Ig (same clone as 68969-4-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using Claudin 1 antibody (68969-4-Ig, Clone: 2D6F6 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 68969-4-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

68969-4-PBS targets Claudin 1 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29478

  Product name: Recombinant human Claudin 1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 102-211 aa of BC012471

  Sequence: MKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV

• Full Name: claudin 1
• Calculated Molecular Weight: 211 aa, 23 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC012471
• Gene Symbol: Claudin 1
• Gene ID (NCBI): 9076
• RRID: AB_3743321
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O95832
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 23 claudins have been identified. They are small (20-27 kilodalton (kDa)) proteins with similar structures. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. Claudin-1 is an integral membrane protein expressed primarily in keratinocytes and normal mammary epithelial cells. Claudin 1 forms tight junctions with other claudin proteins and plays an important role in the intestinal epithelial barrier.