Claudin 1 Recombinant monoclonal antibody, PBS Only (Capture)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Claudin 1 Recombinant monoclonal antibody, PBS Only (Capture) (87782-2-PBS)

Claudin 1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 87782-2-PBS

Clone No.253345A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

Caudin 1, CLDN1, Claudin-1, CLD1, ILVASC

• 

  WB analysis of HT-29 using 87782-2-RR (same clone as 87782-2-PBS)

  HT-29 cells were subjected to SDS PAGE followed by western blot with 87782-2-RR (Claudin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 87782-2-RR (same clone as 87782-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87782-2-RR (Claudin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 87782-2-RR (same clone as 87782-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87782-2-RR (Claudin 1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA sample test of MP03201-1

  The mean Claudin 1 concentration was determined to be 67.6 ng/mL in HUVEC cell extract based on a 1.5 mg/mL extract load and 5.0 ng/mL in MDA-MB-231 cell extract based on a 1.2 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP03201-1

  Sandwich ELISA standard curve of MP03201-1, Human Claudin 1 Recombinant Matched Antibody Pair - PBS only. 87782-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag29269. 87782-1-PBS was HRP conjugated as the detection antibody. Range: 78.1-2500 pg/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 87782-2-RR (same clone as 87782-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 87782-2-RR (Claudin 1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 87782-2-RR (same clone as 87782-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 87782-2-RR (Claudin 1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat colon using 87782-2-RR (same clone as 87782-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat colon tissue using Claudin 1 antibody (87782-2-RR, Clone: 253345A9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse colon using 87782-2-RR (same clone as 87782-2-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using Claudin 1 antibody (87782-2-RR, Clone: 253345A9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HaCaT using 87782-2-RR (same clone as 87782-2-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using Claudin 1 antibody (87782-2-RR, Clone: 253345A9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HaCaT using 87782-2-RR (same clone as 87782-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HaCaT cells using Claudin 1 antibody (87782-2-RR, Clone: 253345A9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array sample test of MP03201-1

  The mean Claudin 1 concentration was determined to be 2.2 ng/mL in A431 cell extract based on a 1.5 mg/mL extract load, 15.2 ng/mL in A549 cell extract based on a 1.2 mg/mL extract load, HCT-116 cell extract were served as a negative control.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP03201-1

  Cytometric bead array standard curve of MP03201-1, Claudin 1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87782-2-PBS. Detection antibody: 87782-1-PBS. Standard: Ag29269. Range: 0.312-40 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87782-2-PBS targets Claudin 1 as part of a matched antibody pair:

MP03201-1: 87782-2-PBS capture and 87782-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29269

  Product name: Recombinant human Claudin 1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 102-211 aa of BC012471

  Sequence: MKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV

• Full Name: claudin 1
• Calculated Molecular Weight: 211 aa, 23 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC012471
• Gene Symbol: Claudin 1
• Gene ID (NCBI): 9076
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95832
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 23 Claudins have been identified. They are small (20-27 kilodaltons (kDa)) proteins with similar structures. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. Claudin-1 is an integral membrane protein expressed primarily in keratinocytes and normal mammary epithelial cells. Claudin 1 forms tight junctions with other claudin proteins and plays an important role in the intestinal epithelial barrier.