Clusterin Monoclonal antibody, PBS Only

• 

  WB analysis of human plasma using 66109-1-Ig (same clone as 66109-1-PBS)

  human plasma were subjected to SDS PAGE followed by western blot with 66109-1-Ig (Clusterin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66109-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66109-1-Ig (same clone as 66109-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver slide using 66109-1-Ig (Clusterin antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 66109-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66109-1-Ig (same clone as 66109-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver slide using 66109-1-Ig (Clusterin antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 66109-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66109-1-Ig (same clone as 66109-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 66109-1-Ig (Clusterin antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 66109-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66109-1-Ig (same clone as 66109-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 66109-1-Ig (Clusterin antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 66109-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 66109-1-Ig (same clone as 66109-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer slide using 66109-1-Ig (Clusterin antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 66109-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 66109-1-Ig (same clone as 66109-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer slide using 66109-1-Ig (Clusterin antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 66109-1-PBS in a different storage buffer formulation.

Clusterin Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 66109-1-PBS

Clone No.2F12G10

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

Apo-J, APOJ, Apo J, Aging-associated gene 4 protein, AAG4

---

Product Information

66109-1-PBS targets Clusterin in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19236

  Product name: Recombinant human CLU protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 101-449 aa of BC010514

  Sequence: VCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

• Full Name: clusterin
• Calculated Molecular Weight: 449 aa, 53 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC010514
• Gene Symbol: CLU
• Gene ID (NCBI): 1191
• RRID: AB_2881508
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P10909
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Clusterin (Apolipoprotein J) is a 75-80 kDa heterodimeric glycoprotein produced by a wide array of tissues and found in most biologic fluids (PMID: 7648419; 11906815). It is encoded by one single gene and cleaved posttranslationally into α (34-36 kDa) and β (36-39 kDa) subunits prior to secretion from the cell. Many functions have been described for clusterin, including regulating apoptosis, transporting lipids, controlling cell interactions, regulating complement (PMID: 10694874).