Cofilin 2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Cofilin 2 Polyclonal antibody, PBS Only (11848-1-PBS)

• 

  WB analysis of human liver using 11848-1-AP (same clone as 11848-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 11848-1-AP (Cofilin 2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 11848-1-AP (same clone as 11848-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 11848-1-AP (Cofilin 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  WB analysis of L02 using 11848-1-AP (same clone as 11848-1-PBS)

  L02 cells were subjected to SDS PAGE followed by western blot with 11848-1-AP (Cofilin 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 11848-1-AP (same clone as 11848-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11848-1-AP (Cofilin 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 11848-1-AP (same clone as 11848-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11848-1-AP (Cofilin 2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 11848-1-AP (same clone as 11848-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 11848-1-AP (Cofilin 2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse liver using 11848-1-AP (same clone as 11848-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11848-1-AP (Cofilin 2 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 11848-1-AP (same clone as 11848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 11848-1-AP (Cofilin 2 antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 11848-1-AP (same clone as 11848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 11848-1-AP (Cofilin 2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 11848-1-AP (same clone as 11848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 11848-1-AP (Cofilin 2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 11848-1-AP (same clone as 11848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11848-1-AP (Cofilin 2 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 11848-1-AP (same clone as 11848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 11848-1-AP (Cofilin 2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 11848-1-AP (same clone as 11848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 11848-1-AP (Cofilin 2 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 11848-1-AP (same clone as 11848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 11848-1-AP (Cofilin 2 antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 11848-1-AP (same clone as 11848-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 11848-1-AP (Cofilin 2 antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

• 

  IF Staining of L02 using 11848-1-AP (same clone as 11848-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed L02 cells using Cofilin 2 antibody (11848-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 11848-1-PBS in a different storage buffer formulation.

Cofilin 2 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11848-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CFL2, CFL 2, NEM7, Cofilin-2, Cofilin2

---

Product Information

11848-1-PBS targets Cofilin 2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2408

  Product name: Recombinant human CFL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC022876

  Sequence: MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL

• Full Name: cofilin 2 (muscle)
• Calculated Molecular Weight: 166 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC022876
• Gene Symbol: Cofilin 2
• Gene ID (NCBI): 1073
• RRID: AB_2080914
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y281
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.