Cofilin Monoclonal antibody, PBS Only

• 

  WB analysis using 66057-1-Ig (same clone as 66057-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66057-1-Ig (Cofilin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66057-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66057-1-Ig (same clone as 66057-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66057-1-Ig (Cofilin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66057-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66057-1-Ig (same clone as 66057-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66057-1-Ig (Cofilin antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66057-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 66057-1-Ig (same clone as 66057-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 66057-1-Ig(CFL1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 66057-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 66057-1-Ig (same clone as 66057-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 66057-1-Ig(CFL1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 66057-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66057-1-Ig (same clone as 66057-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66057-1-Ig (Cofilin antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66057-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66057-1-Ig (same clone as 66057-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66057-1-Ig (Cofilin antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66057-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 66057-1-Ig (same clone as 66057-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66057-1-Ig (Cofilin antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66057-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 66057-1-Ig (same clone as 66057-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 66057-1-Ig (Cofilin antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66057-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66057-1-Ig (same clone as 66057-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Cofilin antibody (66057-1-Ig, Clone: 1G6A2 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red). This data was developed using the same antibody clone with 66057-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Cofilin Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66057-1-PBS

Clone No.1G6A2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

CFL1, Cofilin1, Cofilin, non-muscle isoform, Cofilin 1, 1G6A2

---

Product Information

66057-1-PBS targets Cofilin in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18044

  Product name: Recombinant human Cofilin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-166 aa of BC012318

  Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

• Full Name: cofilin 1 (non-muscle)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC012318
• Gene Symbol: Cofilin
• Gene ID (NCBI): 1072
• RRID: AB_11043339
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23528
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cofilin is a ubiquitous actin-binding protein required for the reorganization of actin filaments. It is a member of ADF (actin-depolymerizing factor)/cofilin family that is a key regulator of actin dynamics and essential for cellular motility, cytokinesis, and endocytosis. Cofilin activity is tightly regulated by phosphorylation and dephosphorylation. Phosphorylation at Ser3 can inhibit its activity, also causing translocation from the nucleus to the cytoplasm.