Cofilin Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Cofilin Recombinant monoclonal antibody, PBS Only (88053-1-PBS)

Cofilin Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 88053-1-PBS

Clone No.260317G7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CFL1, 18 kDa phosphoprotein, Cofilin 1, Cofilin, non-muscle isoform, Cofilin1

• 

  WB analysis using 88053-1-RR (same clone as 88053-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88053-1-RR (Cofilin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88053-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendix using 88053-1-RR (same clone as 88053-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human appendix tissue slide using 88053-1-RR (Cofilin antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88053-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88053-1-PBS targets Cofilin in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1399

  Product name: Recombinant human Cofilin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC012318

  Sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

• Full Name: cofilin 1 (non-muscle)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC012318
• Gene Symbol: Cofilin
• Gene ID (NCBI): 1072
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23528
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cofilin is a ubiquitous actin-binding protein required for the reorganization of actin filaments. It is a member of ADF (actin-depolymerizing factor)/cofilin family that is a key regulator of actin dynamics and essential for cellular motility, cytokinesis, and endocytosis. Cofilin activity is tightly regulated by phosphorylation and dephosphorylation.Phosphorylation at Ser3 can inhibit its activity, also causing translocation from the nucleus to the cytoplasm.