Coilin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Coilin Polyclonal antibody, PBS Only (10967-1-PBS)

• 

  WB analysis using 10967-1-AP (same clone as 10967-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10967-1-AP (Coilin antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10967-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 10967-1-AP (same clone as 10967-1-PBS)

  WB result of Coilin antibody (10967-1-AP; 1:12000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Coilin transfected HEK-293 cells. This data was developed using the same antibody clone with 10967-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 10967-1-AP (same clone as 10967-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 10967-1-AP (Coilin antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10967-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 10967-1-AP (same clone as 10967-1-PBS)

  IP result of anti-Coilin (IP:10967-1-AP, 4ug; Detection:10967-1-AP 1:10000) with HEK-293 cells lysate 1400 ug. This data was developed using the same antibody clone with 10967-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 10967-1-AP (same clone as 10967-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 10967-1-AP (Coilin antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 10967-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 10967-1-AP (same clone as 10967-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 10967-1-AP (Coilin antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 10967-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 10967-1-AP (same clone as 10967-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 10967-1-AP (Coilin antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 10967-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 10967-1-AP (same clone as 10967-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Coilin antibody (10967-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 10967-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HEK-293 using 10967-1-AP (same clone as 10967-1-PBS)

  1X10^6 HEK-293 cells were intracellularly stained with 0.4 ug Anti-Human Coilin (10967-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 10967-1-PBS in a different storage buffer formulation.

Coilin Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 10967-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

COIL, CLN80, p80 coilin, p80-coilin

---

Product Information

10967-1-PBS targets Coilin in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1416

  Product name: Recombinant human COIL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 212-576 aa of BC010385

  Sequence: ANQRCSSPKGSARNSLVKAKRKGSVSVCSKESPSSSSESESCDESISDGPSKVTLEARNSSEKLPTELSKEEPSTKNTTADKLAIKLGFSLTPSKGKTSGTTSSSSDSSAESDDQCLMSSSTPECAAGFLKTVGLFAGRGRPGPGLSSQTAGAAGWRRSGSNGGGQAPGASPSVSLPASLGRGWGREENLFSWKGAKGRGMRGRGRGRGHPVSCVVNRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA

• Full Name: coilin
• Calculated Molecular Weight: 576 aa, 63 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC010385
• Gene Symbol: COIL
• Gene ID (NCBI): 8161
• RRID: AB_2276345
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P38432
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The nuclear coiled body(CBs) and nuclear structures known as gems contain high concentrations of the survival motor neurons (SMN) protein complex. CBs and gems often colocalize, and communication between them is mediated by COIL. COIL is a component of the CBS which are involved in the function or assembly/disassembly of nucleoplasmic snRNPs. During mitosis, CBs disassemble, coinciding with a mitotic-specific phosphorylation of p80 coilin, and symmetrical dimethylation of the COIL RG box motif is a molecular switch that determines whether the SMN complex forms gems or becomes incorporated into CBs