COL8A1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• COL8A1 Polyclonal antibody, PBS Only (17251-1-PBS)

• 

  WB analysis using 17251-1-AP (same clone as 17251-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17251-1-AP (Collagen Type VIII antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17251-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 17251-1-AP (same clone as 17251-1-PBS)

  IP result of anti-Collagen Type VIII (IP:17251-1-AP, 4ug; Detection:17251-1-AP 1:500) with HepG2 cells lysate 1800ug. This data was developed using the same antibody clone with 17251-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 17251-1-AP (same clone as 17251-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using COL8A1 antibody (17251-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 17251-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 17251-1-AP (same clone as 17251-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using COL8A1 antibody (17251-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 17251-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

COL8A1 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 17251-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

COL8, C3orf7, Collagen alpha-1(VIII) chain, Collagen Type VIII

---

Product Information

17251-1-PBS targets COL8A1 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10607

  Product name: Recombinant human COL8A1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 396-744 aa of BC013581

  Sequence: GIPGPMGPPGAIGFPGPKGEGGIVGPQGPPGPKGEPGLQGFPGKPGFLGEVGPPGMRGLPGPIGPKGEAGQKGVPGLPGVPGLLGPKGEPGIPGDQGLQGPPGIPGIGGPSGPIGPPGIPGPKGEPGLPGPPGFPGIGKPGVAGLHGPPGKPGALGPQGQPGLPGPPGPPGPPGPPAVMPPTPPPQGEYLPDMGLGIDGVKPPHAYGAKKGKNGGPAYEMPAFTAELTAPFPPVGAPVKFNKLLYNGRQNYNPQTGIFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPVMYTYDEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGYLLYPM

• Full Name: collagen, type VIII, alpha 1
• Calculated Molecular Weight: 744 aa, 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC013581
• Gene Symbol: COL8A1
• Gene ID (NCBI): 1295
• RRID: AB_10696173
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27658
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.