Complement factor B Monoclonal antibody, PBS Only

• 

  WB analysis of human plasma using 66154-1-Ig (same clone as 66154-1-PBS)

  human blood were subjected to SDS PAGE followed by western blot with 66154-1-Ig (Complement factor B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66154-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66154-1-Ig (same clone as 66154-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66154-1-Ig (Complement factor B antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 66154-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 66154-1-Ig (same clone as 66154-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 66154-1-Ig (Complement factor B antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 66154-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver using 66154-1-Ig (same clone as 66154-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using Complement factor B antibody (66154-1-Ig, Clone: 8D2B6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66154-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human liver using 66154-1-Ig (same clone as 66154-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human liver tissue using Complement factor B antibody (66154-1-Ig, Clone: 8D2B6 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66154-1-PBS in a different storage buffer formulation.

Complement factor B Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 66154-1-PBS

Clone No.8D2B6

Host / Isotype

Mouse / IgM

Reactivity

human

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

CFB, 8D2B6, BF, BFD, C3/C5 convertase

---

Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Product Information

66154-1-PBS targets Complement factor B in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19107

  Product name: Recombinant human CFB protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 574-762 aa of BC007990

  Sequence: DYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLG

• Full Name: complement factor B
• Calculated Molecular Weight: 86 kDa
• Observed Molecular Weight: 93 kDa
• GenBank Accession Number: BC007990
• Gene Symbol: Complement factor B
• Gene ID (NCBI): 629
• RRID: AB_2881550
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Caprylic acid/ammonium sulfate precipitation
• UNIPROT ID: P00751
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Complement factor B (CFB) is a component of the alternative pathway of complement activation. Complement factor B is cleaved into Ba and Bb by factor D in the presence of C3b. The active subunit Bb is a serine protease which associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation.