Use Able AI chat for product recommendations

Complement factor B Recombinant monoclonal antibody

Complement factor B Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 84101-5-RR
Clone No.241141A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

CFB, CFAB, C3/C5 convertase, BFD, BF

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse serum, rat serum, rat plasma, human plasma
Positive IHC detected inmouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84101-5-RR targets Complement factor B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivitymouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0226

Product name: Recombinant human CFB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 574-762 aa of BC007990

Sequence: DYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLG

Predict reactive species
Full Name complement factor B
Calculated Molecular Weight 86 kDa
Observed Molecular Weight 93-100 kDa
GenBank Accession NumberBC007990
Gene Symbol Complement factor B
Gene ID (NCBI) 629
RRIDAB_3671666
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP00751
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Complement factor B (CFB) is a component of the alternative pathway of complement activation. Complement factor B is a 93-100 kDa glycoprotein and is cleaved into Ba (33 kDa) and Bb (60 kDa) by factor D in the presence of C3b (PMID: 11025450). The active subunit Bb is a serine protease that is associated with C3b and forms the alternative pathway for C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation.

Protocols

Product Specific Protocols
IF protocol for Complement factor B antibody 84101-5-RRDownload protocol
IHC protocol for Complement factor B antibody 84101-5-RRDownload protocol
WB protocol for Complement factor B antibody 84101-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Lab Invest

Complement Component 3 Promotes Regeneration of Olfactory Receptor Neurons

Authors - Hiroki Kuwazoe
mouseIHC

PLoS Pathog

C/EBP-β-regulated complement hyperactivation in spleen of SFTSV-infected mice: A clue to targeted complement therapy.

Authors - Yan Liu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Benedicte (Verified Customer) (06-05-2026)

IHC staining of mouse colitic colon (aera of erosion and crypts) using 84101-5-RR. Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 84101-5-RR (Complement factor B Rabbit RecAb) at dilution of 1:400 (40x on NDPview). Heat mediated antigen retrieval with Tris EDTA (pH 8.5)

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:400
Complement factor B Antibody Immunohistochemistry validation (1:400 dilution) in (Cat no:84101-5-RR)
Loading...
||
New chat

Able

正在加载,请稍候...