Cryptochrome 2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85866-1-RR (same clone as 85866-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85866-1-RR (Cryptochrome 2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85866-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 85866-1-RR (same clone as 85866-1-PBS)

  IP result of anti-Cryptochrome 2 (IP:85866-1-RR, 4ug; Detection:85866-1-RR 1:2000) with mouse brain tissue lysate 1720 ug. This data was developed using the same antibody clone with 85866-1-PBS in a different storage buffer formulation.

Cryptochrome 2 Uni-rAb^® Recombinant Antibody for WB, IP, Indirect ELISA

Cat No. 85866-1-PBS

Clone No.250166A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

CRY 2, CRY2, Cryptochrome-2, HCRY2, PHLL2

---

Product Information

85866-1-PBS targets Cryptochrome 2 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag38484

  Product name: Recombinant human CRY2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 243-593 aa of BC041814

  Sequence: HLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKAFPSRYIYEPWNAPESIQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSHPVAEPSSSQAGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPTPELPSKDA

• Full Name: cryptochrome 2 (photolyase-like)
• Calculated Molecular Weight: 593 aa, 67 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC041814
• Gene Symbol: CRY2
• Gene ID (NCBI): 1408
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q49AN0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cryptochrome circadian clock 2 (CRY2) is a flavin adenine dinucleotide-binding protein that is a key component of the circadian core oscillator complex, which regulates the circadian clock. Loss of CRY2 stabilizes c-MYC and enhances cellular transformation. CRY2 can function as a co-factor for the SCF substrate adaptor FBXL3 (PMID: 27840026).