Cyclin A1 Recombinant monoclonal antibody, PBS Only

Cyclin A1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 86151-1-PBS
Clone No.250550D7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

CCNA1, Cyclin A, Cyclin-A1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86151-1-PBS targets Cyclin A1 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4005

Product name: Recombinant human CCNA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 166-465 aa of BC036346

Sequence: GTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ

Predict reactive species
Full Name cyclin A1
Calculated Molecular Weight 464 aa, 52 kDa
Observed Molecular Weight52-55 kDa
GenBank Accession NumberBC036346
Gene Symbol Cyclin A1
Gene ID (NCBI) 8900
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP78396
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CCNA1 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. CCNA1 binds both CDK2 and CDC2 kinases, which give two distinct kinase activities, one appearing in S phase, the other in G2, and thus regulate separate functions in cell cycle. CCNA1 was found to bind to important cell cycle regulators, such as Rb family proteins, transcription factor E2F-1, and the p21 family proteins. In general, the expression of CCNA1 is tissue-specific and high CCNA1 expression is limited to testis; besides, lower levels of CCNA1 expression are also observed in other human cell lines and in healthy brain. Currently, CCNA1 expression has been illustrated to be downregulated in various tumors, including head and neck squamous-cell cancer (HNSCC) and nasopharyngeal carcinoma; and the promoter of the CCNA1 gene is found to be frequently methylated in colon cancer and HNSCC.

Loading...
||
New chat

Able

正在加载,请稍候...