Cyclin A1 Recombinant monoclonal antibody

Cyclin A1 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 86151-1-RR
Clone No.250550D7

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, ELISA

CCNA1, Cyclin A, Cyclin-A1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSKOV-3 cells, rat testis tissue, human testis tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

86151-1-RR targets Cyclin A1 in WB, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag4005

Product name: Recombinant human CCNA1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 166-465 aa of BC036346

Sequence: GTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ

Predict reactive species
Full Name cyclin A1
Calculated Molecular Weight 464 aa, 52 kDa
Observed Molecular Weight52-55 kDa
GenBank Accession NumberBC036346
Gene Symbol Cyclin A1
Gene ID (NCBI) 8900
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP78396
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CCNA1 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. CCNA1 binds both CDK2 and CDC2 kinases, which give two distinct kinase activities, one appearing in S phase, the other in G2, and thus regulate separate functions in cell cycle. CCNA1 was found to bind to important cell cycle regulators, such as Rb family proteins, transcription factor E2F-1, and the p21 family proteins. In general, the expression of CCNA1 is tissue-specific and high CCNA1 expression is limited to testis; besides, lower levels of CCNA1 expression are also observed in other human cell lines and in healthy brain. Currently, CCNA1 expression has been illustrated to be downregulated in various tumors, including head and neck squamous-cell cancer (HNSCC) and nasopharyngeal carcinoma; and the promoter of the CCNA1 gene is found to be frequently methylated in colon cancer and HNSCC.

Protocols

Product Specific Protocols
WB protocol for Cyclin A1 antibody 86151-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...