• Featured Product
  • KD/KO Validated

Cyclin B2 Monoclonal antibody, PBS Only

Cyclin B2 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA
Cat No. 67726-1-PBS
Clone No.2G8B7

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

CCNB2, G2/mitotic-specific cyclin-B2, G2/mitotic specific cyclin B2, Cyclin B, 2G8B7

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67726-1-PBS targets Cyclin B2 in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16329

Product name: Recombinant human CCNB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-243 aa of BC105086

Sequence: MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTS

Predict reactive species
Full Name cyclin B2
Calculated Molecular Weight 398 aa, 45 kDa
Observed Molecular Weight45 kDa
GenBank Accession NumberBC105086
Gene Symbol Cyclin B2
Gene ID (NCBI) 9133
RRIDAB_2882912
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95067
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Cyclin B2 (CCNB2) is a member of cyclin family proteins, which regulate the activities of cyclin dependent kinases (CDKs) and different cyclins function spatially and temporally in specific phases of the cell cycle. Cyclin B2 serves a key role in progression of G2/M transition. Cyclin B2 has been found to be up-regulated in a variety of human cancers, such as adrenocortical carcinoma, breast carcinoma, colorectal adenocarcinoma, pituitary adenoma and gastric cancer. The aberrant expression of Cyclin B2 deregulates spindle checkpoints in the cell cycle and results in chromosomal instability (CIN), one of the signature phenotypes of most cancers. Moreover, serum circulating Cyclin B2 mRNA expression has been found increased in cancer patients and associated with cancer stage and metastasis status.

Loading...
||
New chat Able
正在加载,请稍候...