• Featured Product
  • KD/KO Validated

Cyclin B2 Monoclonal antibody

Cyclin B2 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 67726-1-Ig
Clone No.2G8B7

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, ELISA

CCNB2, G2/mitotic-specific cyclin-B2, G2/mitotic specific cyclin B2, Cyclin B, 2G8B7

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inDU 145 cells, HeLa cells, K-562 cells, Jurkat cells, HEK-293 cells, U2OS cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse testis tissue
Positive IF/ICC detected inPC-12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IHCSee 1 publications below

Product Information

67726-1-Ig targets Cyclin B2 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16329

Product name: Recombinant human CCNB2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-243 aa of BC105086

Sequence: MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSMKEENLCQAFSDALLCKIEDIDNEDWENPQLCSDYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTS

Predict reactive species
Full Name cyclin B2
Calculated Molecular Weight 398 aa, 45 kDa
Observed Molecular Weight45 kDa
GenBank Accession NumberBC105086
Gene Symbol Cyclin B2
Gene ID (NCBI) 9133
RRIDAB_2882912
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO95067
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin B2 (CCNB2) is a member of cyclin family proteins, which regulate the activities of cyclin dependent kinases (CDKs) and different cyclins function spatially and temporally in specific phases of the cell cycle. Cyclin B2 serves a key role in progression of G2/M transition. Cyclin B2 has been found to be up-regulated in a variety of human cancers, such as adrenocortical carcinoma, breast carcinoma, colorectal adenocarcinoma, pituitary adenoma and gastric cancer. The aberrant expression of Cyclin B2 deregulates spindle checkpoints in the cell cycle and results in chromosomal instability (CIN), one of the signature phenotypes of most cancers. Moreover, serum circulating Cyclin B2 mRNA expression has been found increased in cancer patients and associated with cancer stage and metastasis status.

Protocols

Product Specific Protocols
WB protocol for Cyclin B2 antibody 67726-1-IgDownload protocol
IHC protocol for Cyclin B2 antibody 67726-1-IgDownload protocol
IF protocol for Cyclin B2 antibody 67726-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Onco Targets Ther

Exploring Potential Biomarkers and Molecular Mechanisms of Cutaneous Squamous Cell Carcinoma Based on Bioinformatics

Authors - Jiayue Qi
Loading...
||
New chat Able
正在加载,请稍候...