Cyclin D2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67048-1-Ig (same clone as 67048-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67048-1-Ig (CCND2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67048-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67048-1-Ig (same clone as 67048-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67048-1-Ig (CCND2 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67048-1-PBS in a different storage buffer formulation.

Cyclin D2 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67048-1-PBS

Clone No.1A12A8

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse

Applications

WB, Indirect ELISA

Synonyms

CCND2, cyclin D, cyclin D2, G1/S specific cyclin D2, KIAK0002

---

Product Information

67048-1-PBS targets Cyclin D2 in WB, Indirect ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25190

  Product name: Recombinant human CCND2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-289 aa of BC010958

  Sequence: MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL

• Full Name: cyclin D2
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC010958
• Gene Symbol: Cyclin D2
• Gene ID (NCBI): 894
• RRID: AB_2882361
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P30279
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCND2 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. CCND2 forms a complex with and functions as a regulatory subunit of CDK4 or CDK6, whose activity is required for cell cycle G1/S transition. CCND2 has been shown to interact with and be involved in the phosphorylation of tumor suppressor protein Rb. High level expression of CCND2 was observed in ovarian and testicular tumors.