Cyclon/CCDC86 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Cyclon/CCDC86 Polyclonal antibody, PBS Only (14947-1-PBS)

• 

  WB analysis of mouse stomach using 14947-1-AP (same clone as 14947-1-PBS)

  mouse stomach tissue were subjected to SDS PAGE followed by western blot with 14947-1-AP (Cyclon/CCDC86 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14947-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 14947-1-AP (same clone as 14947-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 14947-1-AP (Cyclon/CCDC86 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14947-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 14947-1-AP (same clone as 14947-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 14947-1-AP (Cyclon/CCDC86 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14947-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 14947-1-AP (same clone as 14947-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 14947-1-AP (Cyclon/CCDC86 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14947-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human stomach using 14947-1-AP (same clone as 14947-1-PBS)

  human stomach tissue were subjected to SDS PAGE followed by western blot with 14947-1-AP (Cyclon/CCDC86 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14947-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 14947-1-AP (same clone as 14947-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A549 cells using Cyclon/CCDC86 antibody (14947-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-Phalloidin (red). This data was developed using the same antibody clone with 14947-1-PBS in a different storage buffer formulation.

Cyclon/CCDC86 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 14947-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

14947-1-PBS targets Cyclon/CCDC86 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6754

  Product name: Recombinant human CCDC86 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-360 aa of BC001378

  Sequence: MDTPLRRSRRLGGLRPESPESLTSVSRTRRALVEFESNPEETREPGSPPSVQRAGLGSPERPPKTSPGSPRLQQGAGLESPQGQPEPGAASPQRQQDLHLESPQRQPEYSPESPRCQPKPSEEAPKCSQDQGVLASELAQNKEELTPGAPQHQLPPVPGSPEPYPGQQAPGPEPSQPLLELTPRAPGSPRGQHEPSKPPPAGETVTGGFGAKKRKGSSSQAPASKKLNKEELPVIPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKDFARHLEEEKERRRQEKKQRRAENLKRRLENERKAEVVQVIRNPAKLKRAKKKQLRSIEKRDTLALLQKQPPQQPAAKI

• Full Name: coiled-coil domain containing 86
• Calculated Molecular Weight: 40 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC001378
• Gene Symbol: CCDC86
• Gene ID (NCBI): 79080
• RRID: AB_2072318
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H6F5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CCDC86 (Coiled-coil domain-containing protein 86), also known as Cyclon (cytokine-induced protein with coiled-coil domain) ) is known for its expression in leukocytes in mice, where it regulates the immune response. Cyclon/CCDC86 regulates the apoptosis of T-cells upon activation, a process known as an activationinduced cellular death (AICD), by regulating the expression of the death receptor Fas on T-cells (PMID: 23439384). CCDC86 depletion led to a novel phenotype in which Ki-67 and nucleolin could still accumulate at the chromosome periphery but also formed abnormal cytoplasmic NDF-like foci (PMID: 36695333). The detected molecular weights (MWs) of Cyclon on SDS-PAGE (human Cyclon: 65 kDa; mouse Cyclon: 75 kDa) were higher than calculated MWs (human Cyclon: 40.2 kDa; mouse Cyclon: 46.5 kDa), suggesting possible modifications of Cyclon (PMID: 17300783).