Cystatin B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Cystatin B Polyclonal antibody, PBS Only (10823-1-PBS)

• 

  WB analysis of human saliva using 10823-1-AP (same clone as 10823-1-PBS)

  human saliva were subjected to SDS PAGE followed by western blot with 10823-1-AP (Cystatin B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10823-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 10823-1-AP (same clone as 10823-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 10823-1-AP (Cystatin B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10823-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 10823-1-AP (same clone as 10823-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10823-1-AP (Cystatin B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10823-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 10823-1-AP (same clone as 10823-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 10823-1-AP (Cystatin B antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10823-1-PBS in a different storage buffer formulation.

• 

  IP experiment of MCF-7 using 10823-1-AP (same clone as 10823-1-PBS)

  IP result of anti-Cystatin B (IP:10823-1-AP, 4ug; Detection:10823-1-AP 1:4000) with MCF-7 cells lysate 1320ug. This data was developed using the same antibody clone with 10823-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 10823-1-AP (same clone as 10823-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 10823-1-AP (Cystatin B antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10823-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach using 10823-1-AP (same clone as 10823-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 10823-1-AP (Cystatin B antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10823-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 10823-1-AP (same clone as 10823-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using Cystatin B antibody (10823-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 10823-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10823-1-AP (same clone as 10823-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Cystatin B antibody (10823-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 10823-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Cystatin B Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 10823-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

CSTB, EPM1, Cystatin-B, CST6, CPI-B

---

Product Information

10823-1-PBS targets Cystatin B in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1262

  Product name: Recombinant human CSTB protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-98 aa of BC003370

  Sequence: MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

• Full Name: cystatin B (stefin B)
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC003370
• Gene Symbol: Cystatin B
• Gene ID (NCBI): 1476
• RRID: AB_2086100
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04080
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cystatin B (CSTB), a member of the cystatin superfamily protein, is a stefin that functions as an intracellular thiol protease inhibitor and has been thought to play a role in protecting against the proteases leaking from lysosomes. CSTB plays various functions in a variety of diseases, including epithelial ovarian cancer, colon cancer, and myoclonus epilepsy. Evidence indicates that mutations in CSTB are responsible for the primary defects in patients with progressive myoclonic epilepsy (EPM1). One type of mutation responsible for EPM1 is the expansion in the promoter region of this gene of a CCCCGCCCCGCG repeat from 2-3 copies to 30-78 copies.