Product Information
26979-1-PBS targets Cystatin S in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25619 Product name: Recombinant human CST4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 103-141 aa of BC065714 Sequence: TCAFHEQPELQKKQLCSFEIYEVPWEDRMSLVNSRCQEA Predict reactive species |
| Full Name | cystatin S |
| Observed Molecular Weight | 16 kDa |
| GenBank Accession Number | BC065714 |
| Gene Symbol | Cystatin S |
| Gene ID (NCBI) | 1472 |
| RRID | AB_2880710 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01036 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Cystatins are a family of inhibitors of cysteine peptidases that comprises the salivary cystatins D and S-type (including CST5 and CST4,1,2) and cystatin C-type (CST3) (PMID: 25329717). The D and S-type cystatin have also been detected in seminal plasma, tears, and tracheobronchial fluid but not in other fluids and secretions where cystatin C is found. And the CST4 was expressed in the serous acinar and demilune cells of the human submandibular gland and at lower levels in the serous acini of the parotid gland (PMID:11879580). CST4 specifically combines with cysteine protease to regulate its activity, thus preventing hydrolysis of the extracellular matrix. And some studies propose that CST4 might be a biomarker for gastrointestinal cancer (PMID:29218251; PMID:29636621).





