Cystatin S Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Cystatin S Polyclonal antibody, PBS Only (26979-1-PBS)

• 

  WB analysis of human saliva using 26979-1-AP (same clone as 26979-1-PBS)

  human saliva were subjected to SDS PAGE followed by western blot with 26979-1-AP (Cystatin S antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26979-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 26979-1-AP (same clone as 26979-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 26979-1-AP (Cystatin S antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26979-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 26979-1-AP (same clone as 26979-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 26979-1-AP (Cystatin S antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 26979-1-PBS in a different storage buffer formulation.

Cystatin S Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 26979-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

26979-1-PBS targets Cystatin S in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25619

  Product name: Recombinant human CST4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 103-141 aa of BC065714

  Sequence: TCAFHEQPELQKKQLCSFEIYEVPWEDRMSLVNSRCQEA

• Full Name: cystatin S
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC065714
• Gene Symbol: Cystatin S
• Gene ID (NCBI): 1472
• RRID: AB_2880710
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P01036
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cystatins are a family of inhibitors of cysteine peptidases that comprises the salivary cystatins D and S-type (including CST5 and CST4,1,2) and cystatin C-type (CST3) (PMID: 25329717). The D and S-type cystatin have also been detected in seminal plasma, tears, and tracheobronchial fluid but not in other fluids and secretions where cystatin C is found. And the CST4 was expressed in the serous acinar and demilune cells of the human submandibular gland and at lower levels in the serous acini of the parotid gland (PMID:11879580). CST4 specifically combines with cysteine protease to regulate its activity, thus preventing hydrolysis of the extracellular matrix. And some studies propose that CST4 might be a biomarker for gastrointestinal cancer (PMID:29218251; PMID:29636621).