Cytoglobin Monoclonal antibody, PBS Only

• 

  WB analysis of human heart using 60228-1-Ig (same clone as 60228-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 60228-1-Ig (Cytoglobin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 60228-1-Ig (same clone as 60228-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60228-1-Ig (Cytoglobin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Transfected HEK-293 using 60228-1-Ig (same clone as 60228-1-PBS)

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 60228-1-Ig (Cytoglobin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig heart using 60228-1-Ig (same clone as 60228-1-PBS)

  pig heart tissue were subjected to SDS PAGE followed by western blot with 60228-1-Ig (Cytoglobin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig heart using 60228-1-Ig (same clone as 60228-1-PBS)

  pig heart tissue were subjected to SDS PAGE followed by western blot with 60228-1-Ig (Cytoglobin antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 60228-1-Ig (same clone as 60228-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 60228-1-Ig (Cytoglobin antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 60228-1-Ig (same clone as 60228-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 60228-1-Ig(Cytoglobin antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 60228-1-Ig (same clone as 60228-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 60228-1-Ig (Cytoglobin antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 60228-1-Ig (same clone as 60228-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 60228-1-Ig (Cytoglobin antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 60228-1-Ig (same clone as 60228-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver using 60228-1-Ig(Cytoglobin antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 60228-1-Ig (same clone as 60228-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 60228-1-Ig(Cytoglobin antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 60228-1-Ig (same clone as 60228-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 60228-1-Ig(Cytoglobin antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human bladder using 60228-1-Ig (same clone as 60228-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human bladder using 60228-1-Ig(Cytoglobin antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human bladder using 60228-1-Ig (same clone as 60228-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human bladder using 60228-1-Ig(Cytoglobin antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 60228-1-Ig (same clone as 60228-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Cytoglobin antibody (60228-1-Ig, Clone: 4C7E11 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 60228-1-Ig (same clone as 60228-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Cytoglobin antibody (60228-1-Ig, Clone: 4C7E11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.

Cytoglobin Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60228-1-PBS

Clone No.4C7E11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CYGB, 4C7E11, EC:1.11.1.-, EC:1.14.12.-, EC:1.15.1.1

---

Product Information

60228-1-PBS targets Cytoglobin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4161

  Product name: Recombinant human CYGB protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-190 aa of BC029798

  Sequence: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP

• Full Name: cytoglobin
• Calculated Molecular Weight: 190 aa, 21 kDa
• Observed Molecular Weight: 27-29 kDa
• GenBank Accession Number: BC029798
• Gene Symbol: Cytoglobin
• Gene ID (NCBI): 114757
• RRID: AB_11182383
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8WWM9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cytoglobin is a ubiquitously expressed hexacoordinate hemoglobin that may facilitate diffusion of oxygen through tissues. The protein, with calculated MW of 21 kDa, runs as a 29 kDa one in canine retina, kidney, liver, lung, and heart. It may be caused by posttranslational modification of the protein. Various immuno-staining patterns were reported including nuclear, cytoplasm and extracellular location.