Home
Products
Primary Antibodies
Cytoglobin Monoclonal antibody, PBS Only (60228-1-PBS)

Cytoglobin Monoclonal antibody, PBS Only

Name: Cytoglobin Monoclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 60228-1-PBS-100UG

Cytoglobin Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60228-1-PBS

Clone No. 4C7E11

Review Product

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CYGB, 4C7E11, EC:1.11.1.-, EC:1.14.12.-, EC:1.15.1.1

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis of human heart using 60228-1-Ig (same clone as 60228-1-PBS)
human heart tissue were subjected to SDS PAGE followed by western blot with 60228-1-Ig (Cytoglobin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 60228-1-Ig (same clone as 60228-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 60228-1-Ig (Cytoglobin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Transfected HEK-293 using 60228-1-Ig (same clone as 60228-1-PBS)
Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 60228-1-Ig (Cytoglobin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of pig heart using 60228-1-Ig (same clone as 60228-1-PBS)
pig heart tissue were subjected to SDS PAGE followed by western blot with 60228-1-Ig (Cytoglobin antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of pig heart using 60228-1-Ig (same clone as 60228-1-PBS)
pig heart tissue were subjected to SDS PAGE followed by western blot with 60228-1-Ig (Cytoglobin antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of rat heart using 60228-1-Ig (same clone as 60228-1-PBS)
rat heart tissue were subjected to SDS PAGE followed by western blot with 60228-1-Ig (Cytoglobin antibody at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 60228-1-Ig (same clone as 60228-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart using 60228-1-Ig(Cytoglobin antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human bladder using 60228-1-Ig (same clone as 60228-1-PBS)
Immunohistochemical analysis of paraffin-embedded human bladder using 60228-1-Ig(Cytoglobin antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human bladder using 60228-1-Ig (same clone as 60228-1-PBS)
Immunohistochemical analysis of paraffin-embedded human bladder using 60228-1-Ig(Cytoglobin antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human heart using 60228-1-Ig (same clone as 60228-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart using 60228-1-Ig(Cytoglobin antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 60228-1-Ig (same clone as 60228-1-PBS)
Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Cytoglobin antibody (60228-1-Ig, Clone: 4C7E11 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60228-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Cytoglobin in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

60228-1-PBS targets Cytoglobin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity	human, mouse, rat, pig
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag4161 Product name: Recombinant human CYGB protein Source: e coli.-derived, T-HIS Tag: 6*His Domain: 1-190 aa of BC029798 Sequence: MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP Predict reactive species
Full Name	cytoglobin
Calculated Molecular Weight	190 aa, 21 kDa
Observed Molecular Weight	27-29 kDa
GenBank Accession Number	BC029798
Gene Symbol	Cytoglobin
Gene ID (NCBI)	114757
RRID	AB_11182383
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	Q8WWM9
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Cytoglobin, also named as Histoglobin, HGb, STAP and CYGB, belongs to the globin family. Cytoglobin may have a protective function during conditions of oxidative stress. It may be involved in intracellular oxygen storage or transfer. It serves as a defensive mechanism against oxidative stress both in vitro and in vivo.(PMID:21224051). Cytoglobin is a ubiquitously expressed hexacoordinate hemoglobin that may facilitate diffusion of oxygen through tissues. The protein, with calculated MW of 21 kDa, runs as a 29 kDa one in canine retina, kidney, liver, lung, and heart (PMID: 16505036). It may be caused by posttranslational modification of the protein. Various immuno-staining patterns were reported including nuclear, cytoplasm and extracellular location.