Cytokeratin 14 Recombinant monoclonal antibody

Cytokeratin 14 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, ELISA

Cat No. 83379-1-RR
Clone No.1H22

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

KRT14, 1H22, CK 14, CK14, CK-14

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse skin tissue, rat skin tissue
Positive IHC detected inhuman cervical cancer tissue, human lung cancer tissue, human skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse skin tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83379-1-RR targets Cytokeratin 14 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0188

Product name: Recombinant human KRT14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 262-472 aa of BC002690

Sequence: GQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

Predict reactive species
Full Name keratin 14
Calculated Molecular Weight 472 aa, 52 kDa
Observed Molecular Weight52 kDa
GenBank Accession NumberBC002690
Gene Symbol Cytokeratin 14
Gene ID (NCBI) 3861
RRIDAB_3671033
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP02533
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytokeratin 14, one of about 20 different cytokeratin isotypes of human cells, is the intermediate filament protein characteristic of epithelial cells. Cytokeratin 14 is expressed in the basal compartment of all stratified squamous epithelia. In various kinds of human tumors, the appearance and increasing expression of Cytokeratin 14 were strikingly associated with higher grade and stage of carcinoma, with varying degrees of unfavorable prognosis. In lung squamous cell carcinoma(LSCC), Cytokeratin 14 was expressed in the tumor cell nests showing stromal invasion with fibrosis and lymph node metastases, indicating that Cytokeratin 14 involved in proliferation and metastasis of LSCC. Cytokeratin 14 expression is sometimes used in diagnosis of myoepithelioma1 and intraductal vs. invasive ductal carcinoma of the breast.

Protocols

Product Specific Protocols
IF protocol for Cytokeratin 14 antibody 83379-1-RRDownload protocol
IHC protocol for Cytokeratin 14 antibody 83379-1-RRDownload protocol
WB protocol for Cytokeratin 14 antibody 83379-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...